SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011903777.1.92194 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011903777.1.92194
Domain Number 1 Region: 358-461
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000000000172
Family FHA domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011903777.1.92194
Sequence length 475
Comment PREDICTED: microspherule protein 1 isoform X1 [Cercocebus atys]; AA=GCF_000955945.1; RF=representative genome; TAX=9531; STAX=9531; NAME=Cercocebus atys; AL=Scaffold; RT=Major
Sequence
MTRGTGGTAQRGRSGPDSQGLLDSSLMASGTASRSEDEESLAGQKRASSQALGTIPKRRS
SSRFIKRKKFDDELVESSLAKSSTRAKGASGVEPGRCSGSEPSSSEKKKVSKAPSTPVPP
SPAPAPGLTKRVKKSKQPLQVTKDLGRWKPADDLLLINAVLQTNDLTSVHLGVKFSCRFT
LREVQERWYALLYDPVISKLACQAMRQLHPEAIAAIQSKALFSKAEEQLLSKVGSTSQPT
LETFQDLLHRHPDAFYLARTAKALQAHWQLMKQYYLLEDQTVQPLPKGDQVLNFSDAEDL
IDDSKLKDMRDEVLEHELMVADRRQKREIRQLEQELHKWQVLVDSITGMSSPDFDNQTLA
VLRGRMVRYLMRSREITLGRATKDNQIDVDLSLEGPAWKISRKQGVIKLKNNGDFFIANE
GRRPIYIDGRPVLCGSKWRLSNNSVVEIASLRFVFLINQDLIALIRAEAAKITPQ
Download sequence
Identical sequences A0A2I2Z6Z6 A0A2I3GK72 A0A2I3NGJ2 A0A2I3SQ53 A0A2J8SYJ3 A0A2K5JIV7 A0A2K5N3M2 A0A2K5ZYZ3 A0A2K6DF09 G7N6X0 G7PHT0
ENSGGOP00000001545 ENSNLEP00000021653 ENSGGOP00000001545 ENSP00000349640 ENSP00000349640 ENSP00000349640 ENSNLEP00000021653 NP_001012300.1.87134 NP_001012300.1.92137 XP_004053137.1.27298 XP_008001337.1.81039 XP_008949416.1.60992 XP_009423743.1.37143 XP_011758496.1.29376 XP_011791563.1.43180 XP_011820323.1.47321 XP_011903777.1.92194 XP_012363987.1.23891 XP_015007151.1.72884 XP_015286374.1.63531 XP_016874178.1.92137 XP_016874179.1.92137 gi|59799166|ref|NP_001012300.1| 9598.ENSPTRP00000046538 9606.ENSP00000349640 ENSPTRP00000046538 ENSPTRP00000046538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]