SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011914122.1.92194 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011914122.1.92194
Domain Number 1 Region: 26-193
Classification Level Classification E-value
Superfamily RUN domain-like 3.66e-43
Family RUN domain 0.0000553
Further Details:      
 
Weak hits

Sequence:  XP_011914122.1.92194
Domain Number - Region: 250-318
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0562
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011914122.1.92194
Sequence length 405
Comment PREDICTED: RUN domain-containing protein 3A isoform X4 [Cercocebus atys]; AA=GCF_000955945.1; RF=representative genome; TAX=9531; STAX=9531; NAME=Cercocebus atys; AL=Scaffold; RT=Major
Sequence
MEASFVQTTMALGLSSKKASSRNVAVERKNLITVCRFSVKTLLEKYTAEPIDDSSEEFVN
FAAILEQILSHRFKACAPAGPVSWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENIST
ARAKGRAWIRVALMEKRMSEYITTALRDTRTTRRFYDSGAIMLRDEATILTGMLIGLSAI
DFSFCLKGEVLDGKTPVVIDYTPYLKFTQSYDYLTDEEERHSAESSTSEDNSPEHPYLPL
VTDEDSWYSKWHKMEQKFRIVYAQKGYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQN
QREKRELEGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTLNGAEGASNSK
LYRRHSFMSTEPLSAEASLSSDSQRLGEGTRDEEPWGPIGSSEPN
Download sequence
Identical sequences A0A2J8J4I0 A0A2K5NT80 A0A2K5Z192 A0A2K6B3M8
NP_006686.1.87134 NP_006686.1.92137 XP_008010619.1.81039 XP_011717963.1.29376 XP_011841300.1.47321 XP_011914122.1.92194 XP_014975348.1.72884 XP_016787149.1.37143 GO.36609 O60651 gi|5730015|ref|NP_006686.1| ENSP00000225441 ENSP00000225441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]