SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011915054.1.92194 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011915054.1.92194
Domain Number 1 Region: 17-124
Classification Level Classification E-value
Superfamily PX domain 6.02e-25
Family PX domain 0.0016
Further Details:      
 
Domain Number 2 Region: 190-362
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.1e-19
Family Protein kinases, catalytic subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011915054.1.92194
Sequence length 578
Comment PREDICTED: PX domain-containing protein kinase-like protein isoform X3 [Cercocebus atys]; AA=GCF_000955945.1; RF=representative genome; TAX=9531; STAX=9531; NAME=Cercocebus atys; AL=Scaffold; RT=Major
Sequence
MAFMEKPPAGKVLLDDTVPLTAAIEASQSLQSHTEYIIRVQRGISVENSWQIVRRYSDFD
LLNNSLQIAGLSLPLPPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLD
PNNYSANYTEIALQQVSMFFRSEPKWEVVEPLKDIGWRIRKKYFLMKIKNQPKERLVLSW
ADLGPDKYLSDKDFQCLIKLLPSCLHPYIYRVTFATANESSALLIRMFNEKGTLKDLIYK
AKPKDPFLKKYCNPKKIQGLELQQIKTYGRQILEVLKFLHDKGFPYGHLHTSNVMLDGDT
CRLLDLENSLLGLPAFYRSYFSQFRKINTLESVDVHCFGHLLYEMTYGRPPDSVPVDSFP
PAPSMAVVAVLESTLSCEACKNGMPTVSRLLQMPLFSDVLLTTSEKPQFKIPTKLKEALR
IAKECIEKRLIEEQKQIHQHRRLTRAQSHHGSEEERKKRKILARKKSKRSALENSEEHSA
KYNNSNNSAGSGASSPLTSPSSPTPPSTSGISALPPPPPPPPPPAAPLPPASTEAPAQLS
SQAVNGVSRGALLSSIQNFQKGTLRKAKTCDHSAPKIG
Download sequence
Identical sequences A0A096NRE1 A0A2K5NFN5
ENSPANP00000011075 XP_011915054.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]