SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011915666.1.92194 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011915666.1.92194
Domain Number 1 Region: 50-546
Classification Level Classification E-value
Superfamily Sema domain 2.49e-101
Family Sema domain 0.002
Further Details:      
 
Domain Number 2 Region: 1410-1535,1701-1857
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.88e-33
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 978-1068
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000056
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.063
Further Details:      
 
Domain Number 4 Region: 887-978
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000077
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 5 Region: 1065-1146
Classification Level Classification E-value
Superfamily E set domains 0.00000000000502
Family E-set domains of sugar-utilizing enzymes 0.074
Further Details:      
 
Domain Number 6 Region: 549-601
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000981
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011915666.1.92194
Sequence length 1925
Comment PREDICTED: plexin-D1 [Cercocebus atys]; AA=GCF_000955945.1; RF=representative genome; TAX=9531; STAX=9531; NAME=Cercocebus atys; AL=Scaffold; RT=Major
Sequence
MAPRAAGGAPLSARDAAASPRPFPTPPQYPVPLLLLLLLGAARVGALEIQRRFPSPTPTN
NFALDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPVPDSPLCHAPQLPQASCEHPRRL
TDNYNKILQLDPGQGLVVVCGSIYQGFCQLRRRGNISAVAVRFPPAAPPAEPVTVFPSML
NVAANHPNASTVGLVLPPAAGAGGSRLLVGATYTGYGSSFFPRNRSLEDHRFENTPEIAI
RSLDARGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVSAFLHPPDPPPGAQPYAYLA
LNSEARAGDKESQARSLLARICLPHGAGSDAKKLTESYIQLGLQCAGGAGRGDLYSRLVS
VFPARERLFAVFERPQGSPAARAAPAALCAFRFADVRAAIRAARTACFVEPAPDVVAVLD
SVVQGTGPACERKRNIQLQPEQLDCGAAHLQHPLSILQPLKATPVFRAPGLTSVAVASVN
NYTAVFLGTVNGRLLKINLNESMQVVSRRVVTVAYGEPVHHVMQFDPADSGYLYLMTSHQ
MARVKVAACNVHSTCGDCVGAADAYCGWCALETRCTLQQDCANSSQHHFWTSASEGPSRC
PAMTVLPAEIDVRQEYPGMILQISGSLPSLSGMEMACDYGKNIRTVARVPGPAFGHQIAY
CNLLPRDRFPPFPPNQDHVTVEMSVRVNGRNIVKANFTIYDCSRTAQVYPHTACTSCLSA
QWPCFWCSQQHSCVSNQSRCEASPNPTSPQDCPRTLLSPLAPVPTGGSQNILVPLANTAF
FQGAALECSFGLEEIFEAVWVNESVVRCDQVVLHTTQKSQVFPLSLQLKGRPARFLDSPE
PMTVVVYNCATGSPDCSQCLGREDLGHLCVWSDGCRLRGPLQPMPGTCPAPEIRAIEPLS
GPLDGGTLLTIRGRNLGRRLSDVAHGVWIGGVACEPLPDRYTVSEEIVCVTGPAPGPLSD
IVTVNASKEGKSRDRFSYVLPLVHSLEPPMGPKAGGTRITIHGNDLHVGSELQVLVNDTD
PCTELMRTDTSITCTMPEGALPAPVPVCVRFERRGCVHGNLTFWYMQNPVITAISPRRSP
VSGGRTITVAGERFHMVQNVSMAVHHIGREPTLCKVLNSTLITCPSPGALSNASAPVDFF
INGRAYADEVAVTEELLDPEEAQRGSRFRLDYLPNPQFSTAKREKWIKHHPGEPLTLVIH
KEQDSLGLQSHEYRVKIGQVSCDIQIVSDRIIHCSVNESLGAAEGQLPITIQVGNFNQTI
ATLQLGGSETAIVVSIVICSVLLLLSVVALFIFCTKSRRAERYWQKTLLQMEEMESQIRE
EIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSQTLNS
QGSSQAQETHPLLGEWKIPESCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAVRD
RCSLASLLTIALHGKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSI
CMYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNV
SFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYIL
RDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLIDKKDNTLGRVKDLDTEKYFHLVLPT
DELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYF
FDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQ
AFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIQDMTPLSEQEMNAHLAEE
SRKYQNEFNTNVAMAEIYKYAKRYRPQIMAALEANPTARRTQLQHKFEQVVALMEDNIYE
CYSEA
Download sequence
Identical sequences A0A2K5NIW0
XP_011915666.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]