SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011915871.1.92194 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011915871.1.92194
Domain Number 1 Region: 10-52
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000102
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011915871.1.92194
Sequence length 230
Comment PREDICTED: ropporin-1-like protein [Cercocebus atys]; AA=GCF_000955945.1; RF=representative genome; TAX=9531; STAX=9531; NAME=Cercocebus atys; AL=Scaffold; RT=Major
Sequence
MPLPDTMFCAQQIHIPPELPDILKQFTKAAIRTQPADVLQWSAGYFSALSRGDPLPVKDR
MEMPTATQKTDTGLTQGLLKILHKQCHHKQYVELTDLEQKWKNLCLPKEKFKALLQLDPC
ENRIKWINFLALGCSMLGGSLNTALKHLCEILTDDPEGGPARIPFKTFSYVYRYLAKLDS
DVSSSETESYLASLKENIDTRRNGMIGLSDFFFPKRNLLENRENSEDVGH
Download sequence
Identical sequences A0A096MP03 A0A2K5L0Q7
XP_011915871.1.92194 XP_011915872.1.92194 ENSPANP00000001436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]