SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011916328.1.92194 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_011916328.1.92194
Domain Number - Region: 164-186
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0115
Family Cytochrome c3-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011916328.1.92194
Sequence length 201
Comment PREDICTED: zinc finger C4H2 domain-containing protein isoform X3 [Cercocebus atys]; AA=GCF_000955945.1; RF=representative genome; TAX=9531; STAX=9531; NAME=Cercocebus atys; AL=Scaffold; RT=Major
Sequence
MEKIKARLKAEFEALESEERHLKEYKQEMDLLLQEKMAHVEELRLIHADINVMENTIKQS
ENDLNKLLESTRRLHDEYKPLKEHVDALRMTLGLQRLPDLCEEEEKLSLDYFEKQKAEWQ
TEPQEPPIPESLAAAAAAAQQLQVARKQDTRQTATFRQQPPPMKACLSCHQQIHRNAPIC
PLCKAKSRSRNPKKPKRKQDE
Download sequence
Identical sequences A0A091DCM4 A0A1U7UMR8 A0A2I3HD23 A0A2J8L3Q4 A0A2J8UB90 A0A2K5IRE9 A0A2K5MLC0 A0A2K5YE66 A0A2K6KMS5 A0A2K6RKF4 A0A2K6SHA5 F7CZI7 F7EZ15 G3RYZ9 L5LRQ9 S7Q3H5
ENSP00000338650 ENSMMUP00000009075 NP_001171503.1.87134 NP_001171503.1.92137 NP_001230733.1.87134 NP_001230733.1.92137 XP_003272698.1.23891 XP_003272699.1.23891 XP_004064330.1.27298 XP_004872315.1.39548 XP_005401620.1.28644 XP_005593836.1.63531 XP_005593838.1.63531 XP_005882667.1.60319 XP_007990100.1.81039 XP_007990101.1.81039 XP_007990102.1.81039 XP_008066607.1.4292 XP_008270937.1.1745 XP_008506880.1.77740 XP_008842576.1.79516 XP_008842577.1.79516 XP_011731172.1.29376 XP_011782839.1.43180 XP_011782840.1.43180 XP_011831901.1.47321 XP_011831902.1.47321 XP_011916327.1.92194 XP_011916328.1.92194 XP_011916330.1.92194 XP_012316291.1.9421 XP_014983067.1.72884 XP_016065651.1.3490 XP_016798614.1.37143 XP_017715892.1.44346 XP_017823924.1.60252 XP_018875273.1.27298 XP_018875274.1.27298 XP_021588843.1.77405 gi|295842335|ref|NP_001171503.1| ENSCJAP00000032868 ENSP00000338650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]