SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011923242.1.92194 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011923242.1.92194
Domain Number 1 Region: 585-636
Classification Level Classification E-value
Superfamily Eferin C-derminal domain-like 3.92e-16
Family Eferin C-derminal domain-like 0.00026
Further Details:      
 
Domain Number 2 Region: 18-79
Classification Level Classification E-value
Superfamily EF-hand 0.000000016
Family Calmodulin-like 0.018
Further Details:      
 
Weak hits

Sequence:  XP_011923242.1.92194
Domain Number - Region: 340-414
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0034
Family Mitotic arrest deficient-like 1, Mad1 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011923242.1.92194
Sequence length 637
Comment PREDICTED: rab11 family-interacting protein 4 isoform X1 [Cercocebus atys]; AA=GCF_000955945.1; RF=representative genome; TAX=9531; STAX=9531; NAME=Cercocebus atys; AL=Scaffold; RT=Major
Sequence
MAGGAGWAGAPAALLRSVRRLREVFEVCGRDPDGFLRVERVAALGLRFGQGEEVEKLVKY
LDPNDLGRINFKDFCRGVFAMKGCEELLKDVLSVESAGTLPCAPEIPDCVEQGSEVTGPT
FADGELIPREPGFFPEDEEEAMTLAPPEGPQELDTDSPMESPQSLEGSVGSPAEKDGGLG
GLFLPEDKSLVHTPSMTTSDLSTHSTTSLISNEEQFEDYGEGDDVDCAPSSPCPDDETRT
NVYSDLGSSVSSSAGQTPRKMRHVYNSELLDVYCSQCCKKINLLNDLEARLKNLKANSPN
RKISSTAFGRQLMHSSNFSSSNGSTEDLFRDSIDSCDNDITEKVSFLEKKVTELENDSLT
NGDLKSKLKQENTQLVHRVHELEEMVKDQETTAEQALEEEARRHREAYSKLEREKATEVE
LLNARVQQLEEENTELRTTVTRLKSQTEKLDEERQRMSDRLEDTSLRLKDEMDLYKRMMD
KLRQNRLEFQKEREATQELIEDLRKELEHLQMYKLDCERPGRGRSASSGLGEFNARAREV
ELEHEVKRLKQENYKLRDQNDDLNGQILSLSLYEAKNLFAAQTKAQSLAAEIDTASRDEL
MEALKEQEEINFRLRQYMDKIILAILDHNPSILEIKH
Download sequence
Identical sequences A0A096P3P5 A0A2K5MFN1
XP_011923242.1.92194 ENSPANP00000019970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]