SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011926056.1.92194 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011926056.1.92194
Domain Number 1 Region: 58-244
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.21e-49
Family Astacin 0.00028
Further Details:      
 
Domain Number 2 Region: 415-584
Classification Level Classification E-value
Superfamily TRAF domain-like 4.74e-38
Family MATH domain 0.00085
Further Details:      
 
Domain Number 3 Region: 253-416
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-29
Family MAM domain 0.0051
Further Details:      
 
Domain Number 4 Region: 657-699
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000865
Family EGF-type module 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011926056.1.92194
Sequence length 731
Comment PREDICTED: meprin A subunit alpha isoform X2 [Cercocebus atys]; AA=GCF_000955945.1; RF=representative genome; TAX=9531; STAX=9531; NAME=Cercocebus atys; AL=Scaffold; RT=Major
Sequence
MHSLLYLVFCPHSSCIVHDADFGEQKDISEINLAAGLDLFQGDILLQNSRNGLRDPNTRW
KFPIPYILADNLGLNAKGAILYAFEMFRLKSCVDFKPYEGESSYIIFQQFNGCWSEVGDQ
HVGQNLSIGQGCDYKAIIEHEILHALGFYHEQSRTDRDDYVNIWWDEILSGYQHNFDTYD
DSLITDLNTPYDYESLMHYQPFSFNKNASVPTITAKIPEFNSIIGQRLDFSAIDLERLNR
MYNCTTTHTLLDHCTFEKANICGMIQGTTDDTDWVHQDSAQAGEVDHTLLGQCTGAGYFM
QLSTSSGSAEEAALLESRILYPKRKQQCLQFFYKMTGSPSDRLIVWVRRDDSTGNVRKLV
KVQTFQGDDDHNWKIAHVVLKEEQKFRYLFQGTKGDPQNSTGGIYLDDITLTETPCPTGV
WTVQNFSQVLENTSKGDKLQSPRFYNSEGYGFGLTLYPHGRENSGYLRLAFHVCSGENDA
ILEWPVENRQVIITILDQEPDVRNRMSSSMVFTTSKLHTSPVINDTVIWDRPSRVGTYHT
DCDCFRSIDFGWSGFISHQMLKRRSFLKNDDLIMFVDFEDITHLSQTEVPTKGKRLSPQS
LILQGQELQVSEEGSGKAMLEEVLPVSLSQGQPSRQKRSVENTGPLEDHNWPQYFRDPCD
PNPCQNDGVCVNVKGMASCRCISGPAFFYTGERCQAMQVHGSVLGMVIGGTAGVIFLTFS
IIAILSQRPRK
Download sequence
Identical sequences A0A096NIV6
ENSPANP00000012904 XP_011926056.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]