SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011939052.1.92194 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011939052.1.92194
Domain Number 1 Region: 9-156
Classification Level Classification E-value
Superfamily EF-hand 3.46e-27
Family Calmodulin-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011939052.1.92194
Sequence length 163
Comment PREDICTED: EF-hand calcium-binding domain-containing protein 11 isoform X3 [Cercocebus atys]; AA=GCF_000955945.1; RF=representative genome; TAX=9531; STAX=9531; NAME=Cercocebus atys; AL=Scaffold; RT=Major
Sequence
MFFSEARARSRTWEASPSEHRMWVEVFKACDEDHKGYLSREDFKIAVVMLFGYKPSKIEV
DSVMSSVNPNTSGILLEGFLNIVRKKKEAQRYRNEVRHIFTAFDTYYRGFLTLEDFKKAF
RQVAPKLPERTVLEVFREVDRDSDGHVSFRDFEYALNYGQKEA
Download sequence
Identical sequences A0A096NE42 A0A2K5MZA0 A0A2K6AIV1
XP_011829699.1.47321 XP_011939052.1.92194 ENSPANP00000011150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]