SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011943902.1.92194 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011943902.1.92194
Domain Number 1 Region: 428-499
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000327
Family LIM domain 0.0073
Further Details:      
 
Domain Number 2 Region: 366-433
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000481
Family LIM domain 0.0084
Further Details:      
 
Domain Number 3 Region: 338-364
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000048
Family LIM domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011943902.1.92194
Sequence length 538
Comment PREDICTED: LIM domain-containing protein ajuba isoform X1 [Cercocebus atys]; AA=GCF_000955945.1; RF=representative genome; TAX=9531; STAX=9531; NAME=Cercocebus atys; AL=Scaffold; RT=Major
Sequence
MERLGEKASRLLEKFGRRKGESSRSGSDGTPGPGKGRLSGLGGPRKSGPRGATGGPGDEP
LEPAREQGSLDAERNQRGSFEAPRYEGSFPGGPPPTRALPLPQSLPPDFRLEATAPALSP
RSSFASSSASDASKPSSPRGSLLLDGAGAGGAGGSRPCSNRTSGISMGYDQRHGSPLPAG
PCLFGPPLAAAPAGYSPGGVPSAYPELHAALDRLYAQRPAGFGCQESRHSYPPALGSPGA
LAGAGVGAAGPLERRGAQPGRHSVTGYGDCAVGARYQDELTALLRLTVGTGGREAGARGE
PSGIEPSGLEEPPGPFVPEAARARMRESEAREDYFGTCIKCNKGIYGQSNACQALDSLYH
TQCFVCCSCGRTLRCKAFYSVNGSVYCEEDYLFSGFQEAAEKCCVCGHLILEKILQAMGK
SYHPGCFRCIVCNKCLDGIPFTVDFSNQVYCVTDYHKNYAPKCAACGQPILPSEGCEDIV
RVISMDRDYHFECYHCEDCRMQLSDEEGCCCFPLDGHLLCHGCHMQRLNARQAPANYI
Download sequence
Identical sequences A0A2K5LW23 A0A2K5XAY0 A0A2K6C8P4 F6THL2
9544.ENSMMUP00000011114 XP_001104222.1.72884 XP_011770631.1.29376 XP_011846028.1.47321 XP_011943902.1.92194 ENSMMUP00000011114 ENSMMUP00000011114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]