SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011945642.1.92194 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011945642.1.92194
Domain Number 1 Region: 237-333
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 354-683
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 1.14e-17
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 3 Region: 160-250
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000251
Family I set domains 0.037
Further Details:      
 
Domain Number 4 Region: 2-36
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000277
Family Ovomucoid domain III-like 0.015
Further Details:      
 
Domain Number 5 Region: 82-154
Classification Level Classification E-value
Superfamily EF-hand 0.000000641
Family Calmodulin-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011945642.1.92194
Sequence length 745
Comment PREDICTED: follistatin-related protein 4 isoform X4 [Cercocebus atys]; AA=GCF_000955945.1; RF=representative genome; TAX=9531; STAX=9531; NAME=Cercocebus atys; AL=Scaffold; RT=Major
Sequence
MPVCGSDGRFYENHCKLHRAACLLGKKITVIHSKDCFLKGDTCTIAGYARLKNVLLALQT
RLQPLREGDSRQDPASQKRLLVESLFRDLDADGSGHLSSSELAQHVLKKQDLDEDLLGCS
PGDLLRFDDYNSDSSLTLREFYMAFQVVQLSLAPEDRVSVTTVTVGLSTVLTCAVRGDLR
PPIIWKRNGLTLNFLDLEDINDFGEDDSLYITKVTTIHMGNYTCHASGHEQLFQTHVLQV
NVPPVIRVYPESQAQEPGVAASLRCHAEGIPMPRITWLKNGVDVSTQMSKQLSLLANGSE
LHISSVRYEDTGAYTCIAKNEVGVDEDISSLFIEDSARKTLANILWREEGLSVGNMFYVF
SDDGIIVIHPVDCEIQRHLKPTEKIFMSYEEICPQREKNATQPCQWASAVNVRNRYIYVA
QPALSRVLVVDIRAQKVLQSIGVDPLPAKLAYDKSHDQVWVLSWGDVHKSQPSLQVITEA
SAGQDQHLIRTPFAGVDDFFIPPTNLIINHIRFGFIFNKSDPAVHKVDLETLMPLKTIGL
HHHGCVPQAMAHTHLGGYFFIQCRQDSPASAARQLLVDSVTDSVVGPNGDVTGTPHTSPD
GRFIVSAAADSPWLHVQEITVRGEIQTLYDLQINPGISDLAFQRSFTESNQYNIYAALHT
EPDLLFLELSTGKVGTLKNLKEPPTGPPQPWGCARRIMRDSGLFGQYLLTPARESLFLIN
GRQNTLRCEVSGIKGGTTVVWVGEV
Download sequence
Identical sequences XP_011945640.1.92194 XP_011945641.1.92194 XP_011945642.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]