SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011949349.1.92194 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011949349.1.92194
Domain Number 1 Region: 459-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.14e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 543-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 179-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 403-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.12e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 5 Region: 235-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 6 Region: 294-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 347-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.26e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 3-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-20
Family KRAB domain (Kruppel-associated box) 0.00054
Further Details:      
 
Domain Number 9 Region: 141-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.86e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 585-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-18
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 11 Region: 506-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000543
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 12 Region: 94-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000991
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011949349.1.92194
Sequence length 644
Comment PREDICTED: zinc finger protein 709 isoform X3 [Cercocebus atys]; AA=GCF_000955945.1; RF=representative genome; TAX=9531; STAX=9531; NAME=Cercocebus atys; AL=Scaffold; RT=Major
Sequence
MNPWDSVVFEDVAVNFTQEEWALLGPSQKKLYRDVMQETFVNLASIGENWEEKNTEDHKN
QGRKLRSHMVERLCERKEGSQFGETISQTPNPKPNKKTFTRVKPYECSVCGKDYMCHSSL
NRHMRSHTEHRSYEYHKYGEKSYECKECGKRFSFRSSFRIHERTHTGEKPYKCKQCGKAF
SWPSSFQIHERTHTGEKPYECKECGKAFIYHTTFRGHMRMHTGEKPYKCKECGKTFSHPS
SFRNHERTHSGEKPYECKQCGKAFRYYQTFQIHERTHTGEKPYQCKQCGKALSCPTSFRS
HERIHTGEKPYKCKKCGKAFSFPSSFRKHERIHTGEKPYDCKECGKAFISLPSYRRHMIM
HTGNGPYKCKECGKAFDCPSSFQIHERTHTGEKPFECKQCGKAFSCSSSFRMHERTHTGE
KPHECKQCGKAFSCSSSVRIHERTHTGEKPYECKQCGKAFSCSSSFRMHERIHTGEKPYE
CKQCGKAFSFSSSFRMHERTHTGEKPYECKQCGKAFSCSSSFRMHERTHTGEKPYECKQC
GKAFSCSSSIRIHERTHTGEKPYECKQCGKAFSCSSSVRMHERTHTGEKPYECKQCDKAF
SCSRSFRIHERTHTGEKPYACQQCGKAFKCSRSFRIHERVHSGE
Download sequence
Identical sequences XP_011949349.1.92194 XP_011949350.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]