SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011954866.1.66739 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011954866.1.66739
Domain Number 1 Region: 50-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.32e-34
Family SCAN domain 0.00012
Further Details:      
 
Domain Number 2 Region: 222-283
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 757-808
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.91e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 834-886
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-16
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 972-1024
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-16
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 6 Region: 480-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000143
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 7 Region: 591-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000731
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 8 Region: 675-727
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000688
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 517-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000478
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 10 Region: 877-915
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000025
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011954866.1.66739
Sequence length 1027
Comment PREDICTED: zinc finger protein 445 isoform X1 [Ovis aries]; AA=GCF_000298735.2; RF=representative genome; TAX=9940; STAX=9940; NAME=Ovis aries; breed=Texel; AL=Chromosome; RT=Major
Sequence
MPPGRWYAVHPAQAKASRERGRLQMIKKEEEDESYTSVPAARPQTLNRPGQELFRQLFRQ
LRYHESSGPLETLSRLRELCRWWLRPDVLSKAQILELLVLEQFLSILPEELRTWVQLHHP
ESGGEAVALLEELQRDFDETPWRDPAPAQSPDVHWMGTGALRAAQIWPPASPLRSGSALG
DHLQPPYEIGVRDFLAGQPDPPAAEVPALCSKEGCPGNQVTAQPQGTMTFKDVEVTFSQD
EWGLLDASQRNLYRDVMLENYGNMASVVGPFTKPALISWLEAREPWGLNVQGVQLKGNPG
AAPAGEELHVKTDKFILKPEPLEEAVTLATPSECHGAATVSEGPGLRESVAQKSRLKERC
GNPTQVRVKKEETNSSHGAGKDCEDSGRNNSLHLRHITYLRGPRRKQSLKHGYGKHFRGS
SYHYDYKEYGKGLRRMMGGFSLHQRIHAGLKGKAKDAHGKDFSLSSHHKHGQNLHVVGTL
YKCSDCGRTFSCSSHLVCHQRLHTQEKPFKCRACGKAFRWSSNRVRHEKIHTRLKPYKCS
LCDKAFRRMSVYRLHQEAHAKQKYLESTQDEEALTCDSDSDHHLRDQSGERLFDCSQCRK
SFHCKSYILEHQRIHTQEKPYKCPKCRKTFRWRSNFTRHMRLHQEEKFYDLDKCREELRQ
TSNSSQPQSAPTMEKALVCQQCGKTFIRKKTLINHQRIHTAEKPYRCHECAEEFPHRSAY
IVHKRQHATERKPEDAPSFSHDRAFQVPQTSPTTEEPYKCSQCGKVFRSHSFLLIHHRVH
TREKPYKCKECGKSFRWSSNLSRHQRTHSLGKLDEYSESEDALNLQSQVLTSAKPFQCQE
CGKNFTRKRSLLDHEGIHSGEKRYKCNLCGKSYDRNYRLVNHQRIHTKERPFKCQCCGKD
FIGKHTLSIHQRKHIRAAESESGVAGLTSHRETGVKLHELKSGEENPLEDDEKTCDQRSE
LPGLQDIPTRGKCHKCSTCGKTFSKSSQLTSHKRFHTRERPFKCRECGKTFRWSSNLARH
MKNHTRD
Download sequence
Identical sequences W5P310
XP_004018309.1.66739 XP_011954866.1.66739 XP_011978617.1.54773 XP_011978618.1.54773 ENSOARP00000004810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]