SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011959830.1.66739 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011959830.1.66739
Domain Number 1 Region: 72-199
Classification Level Classification E-value
Superfamily EF-hand 1.29e-25
Family Calmodulin-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011959830.1.66739
Sequence length 261
Comment PREDICTED: calcium-binding protein 8 isoform X1 [Ovis aries]; AA=GCF_000298735.2; RF=representative genome; TAX=9940; STAX=9940; NAME=Ovis aries; breed=Texel; AL=Chromosome; RT=Major
Sequence
MRLPEQPGEGKPENEEKGGRGAPGGGEEPPRTQAPDFPTWEKMPFHHVTAGLLYKGNYLN
RSLSAGSDSEQLANISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELA
IIMQRLDMDGDGQVDFDEFMTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQRITLEELKH
ILYHAFRDHLTMKDIENIIINEEESLNETSGNCQTEFEGVHSQKQNRQTCVRKSLICAFA
MAFIISVMLIAANQILRSGME
Download sequence
Identical sequences E1BDZ7 W5PM14
ENSBTAP00000053698 9913.ENSBTAP00000053698 ENSOARP00000011488 ENSBTAP00000053698 XP_011959826.1.66739 XP_011959827.1.66739 XP_011959829.1.66739 XP_011959830.1.66739 XP_011959831.1.66739 XP_011999153.1.54773 XP_011999154.1.54773 XP_011999156.1.54773 XP_011999157.1.54773 XP_011999158.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]