SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011963469.1.66739 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011963469.1.66739
Domain Number 1 Region: 158-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000904
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 98-154
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000324
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 3 Region: 37-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000734
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011963469.1.66739
Sequence length 234
Comment PREDICTED: complement factor H isoform X1 [Ovis aries]; AA=GCF_000298735.2; RF=representative genome; TAX=9940; STAX=9940; NAME=Ovis aries; breed=Texel; AL=Chromosome; RT=Major
Sequence
MYVLCVCSTQHLILCDTNDIYFAMVKYSHSIISIERECSIPQMDAYLNAYPRKDTFKVGD
VLKFSCSQGRIMVGADSVQCYHFGWSPKLPTCKAKKVKGCAPPPQLLNGKGKEIHKEEYA
HNEVVEYACKPRFLMKGSHKIQCVDGRWTALPVCIEEERTCGDIPDLDHGDIKPSVPPYH
HGDSVELSCREAFTMIGPRFITCISGEWTQPPQCIGQNTHLKLTFSICSHTVEI
Download sequence
Identical sequences W5QAN8
ENSOARP00000019783 XP_011963469.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]