SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011967335.1.54773 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011967335.1.54773
Domain Number 1 Region: 546-576,714-788
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000549
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011967335.1.54773
Sequence length 960
Comment PREDICTED: testis anion transporter 1 isoform X5 [Ovis aries musimon]; AA=GCF_000765115.1; RF=na; TAX=9938; STAX=9940; NAME=Ovis aries musimon; AL=Scaffold; RT=Major
Sequence
MQPDRSFQSFASRYRQSSFTYDVKRDVYNEENFQQEHRKKTASSGNADIDISTVSHHVEC
RCSWYKFQRCLLTVFPFLEWMCFYRFKDWLLGDLLAGISVGLVQIPQVLMLGLLARHLIP
PLNVSYAAFCASVIYGIFGSCHQMSIGTFFLVSALTINVLRTEPFNSGHLLLGTFIQDDF
SNITFYENYNRSLSSVASVTLLTGIIQLSMGMLGFGFIVTYIPEAAISGYLAATALHVML
SQLTCIFGVMISYNSGPIAFFYNIINYCLGLPKANSTSILLFLTTIVALRINKCIRICFN
QYPIEFPMEVFLILGFAAFSNKVNMATENSLMLIEMIPYSFLFPVTPDMSNLTEVLAESF
SLALVSSFLLIFLGKKIASFHNYDVNSNQDLIAIGLCNVVSSFFRSYVFTGAVARTIIQD
KTGGRQQFASLVGAGLMLLLMMKMAHFFYKLPNAIVAGIILSNVLPYLEVVYTLPSLWRQ
NQYDCLIWMVTFMSAILLGLDIGLVVAVTFAFFIITVQSHRTKILLLGQIPNTNIYRSFQ
DYREVANIPGVKIFQCCNAITFVNVHYLKRKVLEEIEMVKMPLTDEEIYTLFSPNEEGAQ
RGKICRCYCNCDEPEPLPRVIYTERYEVQRGRESSFINLVRCSRFESMDTGQSISEDQVP
YITSSSSQRNPNYEEVEKVWLSDDPSRSMTITLPEASDTQVRATKLLPYSTSTVLPSVHT
IILDFSMVHLVDAQALVVLRQMFCAFQNANILVLIAGCHSFVVRSLEKNDFFNAGITKAQ
LFLTLHDAVLFALSRKLPESSELSVDESETVIQETFSETDKKEESRHKTSRSFIEAPRSK
SPAFSLLPDPEMEEESNLDLYSTIQMSKDHGLDLDLDLDREVEPESELEPESELDQETEL
EPDPEASHKPTRQKYWSLFRAIIPRSPTHTQARTQSVDRRHQNVKPYTSKADTSEDALEI
Download sequence
Identical sequences W5PSZ6
XP_004018826.1.66739 XP_011967335.1.54773 ENSOARP00000013576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]