SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011969707.1.54773 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011969707.1.54773
Domain Number 1 Region: 56-552
Classification Level Classification E-value
Superfamily Sema domain 1.44e-99
Family Sema domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1416-1541,1707-1863
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-34
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 3 Region: 984-1074
Classification Level Classification E-value
Superfamily E set domains 0.000000000000043
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.048
Further Details:      
 
Domain Number 4 Region: 893-984
Classification Level Classification E-value
Superfamily E set domains 0.000000000000159
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 5 Region: 1072-1152
Classification Level Classification E-value
Superfamily E set domains 0.0000000000691
Family E-set domains of sugar-utilizing enzymes 0.065
Further Details:      
 
Domain Number 6 Region: 555-607
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000249
Family Plexin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011969707.1.54773
Sequence length 1931
Comment PREDICTED: plexin-D1 isoform X2 [Ovis aries musimon]; AA=GCF_000765115.1; RF=na; TAX=9938; STAX=9940; NAME=Ovis aries musimon; AL=Scaffold; RT=Major
Sequence
MARRAAGGAPLSARAAAASPLPPRPPFRAPQCPPPPPPLWLLLLLGAARVGALEIQRRFP
SPTPTNNFALDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPVADSPLCHAPQLPQASC
EHPRRLTDNYNKILQLDPGQGLVVVCGSVYQGFCQLRRRGNISAVAVPFPPAAPPAAPVT
VFPSMLNVAANHPNASTVGLLLPPAAGAGGSRLLVGATYTGYGSAFFPRNRSLEDHRFEN
TPEIAIRSLDARGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVRAFLHPPDPRPGAQ
TYAYLALNSEARAGDKESQARSLLARICLPRGAGGDAKKLTESYIQLGLQCAGGAGRGDL
YSRLVSVFPTRELLFAVFERPQGTPGARAAPAALCAFRFADVQAAIRAARTACFVDPAPD
VVAVLDSVVQGTGPACERKRNIQLQPEQLDCGAAHLQHPLSVLQPLKALPVFRAPGLSSV
AVASVGNYTVVFLGTVSGRLLKINLNESMQVVSRKVVTLAYGEPVHHVMQFDPVDPGYLY
LMTSHQMARVKVAACAAHTTCGDCVGAADAYCGWCTLETRCTLRQDCANSSQPHFWTSAS
AGPSRCPAMTVLPAEINVHQEYPGMILQISGSLPSLSGMEMACDYGHGIRTVARVPGPAF
GHQIAYCNLLPRDQFPPFPPHQDHVTVEMSVRVQGQSIVRASFTIYDCGRVGQVYPHTAC
TSCLSAQWPCFWCAQQHACVSNQSRCEASPNPTSPQECPQILPSPLAPMPTGGFQSIPVH
LASATFFQGAALECSFGLEETFEAVWVNESAVRCKQVVLHTTQKSQVFPLSLQLKGRPAR
FLDSPDPMTVEVYNCAVGSPDCSQCLGREDLGHLCVWSDGCRPRGTMQPLPGTCPAPEIR
AIEPLSGPLDGGTQLTIRGRNLGRRFSDVAHGVWIGSVACEPLADRYTVSEEIVCATGPA
TEAFSDVVTVNASKEGRSQERFSYVLPLVHSLEPAMGPKAGGTRITIHGSDLHVGSELQV
LVNNTEPCTELLRSDASIACTVPGGTLPAVVPVCVRFEQRGCVHGGLNFQYMPNPVITAI
SPHRSHVSGGRTITVAGERFHMVQKVSMAVHHIGREPTLCKVLNSTLITCPSPGALSNAS
APVDFFLNGRVYADEAAVAEELLEPEEAQRGSQFRLDYLPDPQFSTAKREKWIKHHPGEP
LTLVIHKEQDGLGLESHEYRVKIGQVACDIQIVSERVIHCSVNESLGTAEGQLPITIQVG
NFNQTIATLQLGGSETAIIVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEM
ESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLP
SQTLNSQGSSPVQETHPLLGEWKIPESCRPNMEEGISLFSSLLNNRHFLIVFVHALEQQK
DFAVRDRCSLASLLTIALHGKLEYYTGIMKELLVDLIDASAAKNPKLMLRRTESVVEKML
TNWMSICMYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAK
PRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASS
TQSYILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLTDKKDNTLGRVKDLDTEKYF
HLVLPTDELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPP
LAVKYFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIEKTDHIDAC
LSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMTPLSEQEMN
AHLAEESRKYQNEFNTNVAMAEIYKYAKRYRPQIVSALEANPTARRTQLQHKFEQVVALM
EDNIYECYSEA
Download sequence
Identical sequences XP_011969707.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]