SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_011975732.1.54773 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011975732.1.54773
Domain Number 1 Region: 158-271
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-28
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 2 Region: 366-480
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000419
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 569-606
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000563
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 279-316
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 325-364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 530-567
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000275
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011975732.1.54773
Sequence length 885
Comment PREDICTED: low-density lipoprotein receptor-related protein 3 isoform X2 [Ovis aries musimon]; AA=GCF_000765115.1; RF=na; TAX=9938; STAX=9940; NAME=Ovis aries musimon; AL=Scaffold; RT=Major
Sequence
MSGGTCCQGIVEAVSGFLLLTRLVVWRDRLTHVMKEGQTWVPAGLAFSGQYGGETRPPRG
LHPVEKASRPQWVLLCLRPVLGAEGTGVTPTLADGASDSGCNVCFRDSMLGEDVLPTLPR
DHPPHPASWRRRHPDFTPARVSPGEASASQPPLLTAACSGQLERHTARRGVIYSPAWPLN
YPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLMLGPAAPPRQEAFRLCGSAIP
PAFISARDHVWIFFHSDTSSSGQAQGFRLSYIRGKLGQASCQADEFRCDNGKCLPGPWQC
NTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPAERRCDGTQDCGDGSD
EAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDPRRVLLQLELRLGYD
DYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNATYQVK
GYCLPWEQPCGSSREGDAEDPGEQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYPCEG
GSGLCYTPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQDGSD
EHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLEAEFV
RREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSRRRLG
RLWNRLFHRPRAPRGQIPLLTAARTSQTVLGDGLLQPAPGAARDPPAPLTDTSSPGAAGE
GPPGAPSHASEVGPSVPPASGLRDPLESRPADKDRKAGRDPLVASPAPVDVPQESCSGQD
PHPLALTAGSTLGPHPSEPLGVCRSPPPPCSPTLEASDDEALLVC
Download sequence
Identical sequences XP_011975732.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]