SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011977287.1.54773 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011977287.1.54773
Domain Number 1 Region: 2205-2299
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-31
Family Link domain 0.00014
Further Details:      
 
Domain Number 2 Region: 505-643
Classification Level Classification E-value
Superfamily FAS1 domain 6.28e-29
Family FAS1 domain 0.0018
Further Details:      
 
Domain Number 3 Region: 1469-1517,1595-1709
Classification Level Classification E-value
Superfamily FAS1 domain 1.2e-27
Family FAS1 domain 0.0023
Further Details:      
 
Domain Number 4 Region: 1711-1864
Classification Level Classification E-value
Superfamily FAS1 domain 4.97e-24
Family FAS1 domain 0.0048
Further Details:      
 
Domain Number 5 Region: 961-1118
Classification Level Classification E-value
Superfamily FAS1 domain 3.53e-23
Family FAS1 domain 0.0045
Further Details:      
 
Domain Number 6 Region: 384-497
Classification Level Classification E-value
Superfamily FAS1 domain 3.92e-19
Family FAS1 domain 0.0071
Further Details:      
 
Domain Number 7 Region: 2296-2459
Classification Level Classification E-value
Superfamily FAS1 domain 1.09e-16
Family FAS1 domain 0.0085
Further Details:      
 
Domain Number 8 Region: 1127-1250
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000085
Family FAS1 domain 0.0061
Further Details:      
 
Domain Number 9 Region: 1541-1578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000067
Family Merozoite surface protein 1 (MSP-1) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011977287.1.54773
Sequence length 2568
Comment PREDICTED: stabilin-1 isoform X2 [Ovis aries musimon]; AA=GCF_000765115.1; RF=na; TAX=9938; STAX=9940; NAME=Ovis aries musimon; AL=Scaffold; RT=Major
Sequence
MAGPRGHLLLCFLALCLAGPSFFGEQKVRSKRCDVKTKFVTHIPCTPCPAIKKRACPLGW
TRAFPEKISQDCRYEVQLGDSLLSMSGCSLECWKDMVQKACCPGYWGSQCYECPGGAETP
CSGHGTCLDGIDGNGTCVCQENFGGSACQECRDPNRFGPDCQSVCRCVYGVCRHGPRGDG
SCLCFAGYTGAHCDHELLACRALNCPRNSQCSEEAPSCSCLPGYTQQGHECRASDPCRPS
PCSPLAQCSVGPRGQAQCRCPENYYGDGTVCLPQDPCTTNNGGCPSNSTLCLYRRPGQAS
CLCKPGLVSIAHDSSAGCFAHCSAFSCDRSATCQVTPDGKTSCVCKEGEVGDGRACYGHL
LHEVQKASQTSMLLRLRVAFAMLDQGCREILSTSGPFTVLAPLVSSRTMNASVAQQLCRQ
HVIAGQHMLEEAGAQAPRRWWTLAGQEITVSFSRFRKYTYKYQDQPQQTFTIHKANYPAA
NGLFHVVTALRVQPPPELPEDPKRTIGQILASNEVFTRFETILENCGLPSFLDGPGPFTV
FAPSNEAVDGLRDGRLVYLFTAGLSKLQELVRYHVYNHGQLTVEKLISKGRVLTMANQIL
AVNISEEGRILLGPEGVPLRRVDVLAANGVIHMLEGILLPPTILPILPKLCNEEQHAVVA
GSCVDCQALNTSTCPPNSVKLDISPEECVYIHDPTGLNVLRKGCAHYCNQTIQKPGCCKG
FFGPDCLQCPGGFSNPCYGKGNCSDGVQGSGACLCFPDYKGIACHICSNPNKHGEQCQED
CGCVHGLCDNRPGSGGVCQRGTCAPGFSGRFCNESTVSCGSTEQAQQCHPHARCVNQGGV
SRCLCLDAFEGDGFSCTPSDPCSRPDRGGCSENAECVPGARGAHHCTCHKGWSGDGRVCV
AIDECELDSRGSCHADALCSYVGPGQSRCTCKLGFAGDGYMCSPIDPCRAGNGGCHDLAT
CRAVGGGQRVCTCPPGYGGDGFSCYGDILKELEANAHFSVFYQWVKGAGITFPADSQVTA
LVPSESAIRRLSSKDQAFWLQPRLLPQLVRAHFLQGALSEEELARLHGQNVSTLNPTVRW
EIHNVSGRVWVQNASVDVADLLATNGVLHVLSQVLLPPRGDVPGGQGLLQQLDAVPAFHL
FRELLQRHRLVPQIEAATAYTIFVPTNRSLEAQANSSSLDSDVVRHHVILGEALSTEALG
KGGHRSSLLGPAHWLVFYNHSGQPEVNHVPLEGPVLQAPGRSLFGLSGVLTVGSSRCLHS
HAEALREKCVNCSRKFRCTQGYQLEDTPRKSCVYRSGYTFSRGCSYTCAKKIQVPDCCPG
FFGTLCEPCPGGLGGVCSGHGQCQDRLLGSGECRCHEGFHGMACEMCELGRYGPNCTGVC
DCAHGLCQEGLRGDGSCICNVGWQGLRCDQKISGPQCLQKCDPNANCVQDSAATPACVCA
AGYSGDGVSCSAVDPCARDHGGCSPHANCTTVAPGQRTCTCLDGYTGDGELCQEANSCLI
RHGGCHMHAECIPTGPQQVSCSCREGYSGDGIRACVLLDPCSQNNGGCSPYAVCKSTGDG
QRTCACDAVRTVGDGFTCRARVSLELLRDKHASFFSLHLLEYKDLKGDGPFTVFVPHADL
MTNMSQDELARIRANRQLVFRYHVVGCRQLRSQELLEEGYATTLSGHPLRFSEREGNIYI
NDFARVVSSDQEAVNGVLHFIDRVLLPPEALHWEADAAPAPRRNFTAAAEAFGYKIFSGL
MTMAGLLPLLQDSFHRPLTMLWPTDSALQALPPDRQVWLYHKDHRDKLAAILRGHVIRNV
EALAADLPNLGPLRTMHGTPISFSCSHARPGALTVGEDAARIVQRHLPFEGGLAYGIDQL
LEPPGLGARCDRFETRPLWLKVCSICGLEPPCPPGSQEQGSPEACWRYLSKFWTSPSLHP
LALRSVWTRPSHWGQPRGLGRGCYRNCVTTTWKPSCCPGHYGSECRACPGGASSPCNHRG
TCMDGMSGSGECRCHVHFTGTACELCAPGAFGTLCQACNCTSHGRCDEGLGGSGSCFCDE
GWTGPRCEVQLELQPVCAPPCAPQAVCRAGNSCECSLGYEGDGRTCTVVDLCQDGRGGCS
EHANCSQVGTAVTCTCWPDYAGDGWSCRARNPCEDGHRGGCSEHADCLNTGPNTRRCVCH
AGYVGDGLQCLLEPEPPVDRCLDRPPPCHADAVCTDLHFQEKRAGVFHLQAPSGPYGLNF
SEAEAACGAQGAVLASLLQLSAAQQLGFHLCLVGWLANGSAAHPVVFPAADCGDGQVGVV
SLGARENLSERWDAYCFRMRDVACRCRDGFVGDGTSVCNGKLLDVLATTANFSTFYGMLL
SYANATPRGLEFLDFLDDERTYKTLFVPVNEGFVDNMTLSGPDLELHASNTTFLSTNASQ
GALLPAHSGLSLVVSDLGPGNSSRAPEVPGAVVVSRVITWDILAFNGIIHTLASPLLAPP
QARAVVAPEAPSVTAGVGAAVAAGAVLGLVAGALYLRARSRSTGFGFSAFQAEDAAADDF
SPWQEGTSPTLVSVPNPVFGSHEAFCEPFDDSLLEEDFPDTQRILEVK
Download sequence
Identical sequences XP_011977287.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]