SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011980516.1.54773 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011980516.1.54773
Domain Number 1 Region: 223-400
Classification Level Classification E-value
Superfamily MIR domain 6.98e-50
Family MIR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1087-1200
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.66e-18
Family SPRY domain 0.026
Further Details:      
 
Domain Number 3 Region: 3998-4076
Classification Level Classification E-value
Superfamily EF-hand 0.00000000077
Family Calmodulin-like 0.051
Further Details:      
 
Domain Number 4 Region: 665-813
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000673
Family SPRY domain 0.052
Further Details:      
 
Domain Number 5 Region: 107-188
Classification Level Classification E-value
Superfamily MIR domain 0.0000034
Family MIR domain 0.021
Further Details:      
 
Domain Number 6 Region: 430-554
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000366
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 7 Region: 2153-2218
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000981
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_011980516.1.54773
Sequence length 4956
Comment PREDICTED: ryanodine receptor 2 isoform X24 [Ovis aries musimon]; AA=GCF_000765115.1; RF=na; TAX=9938; STAX=9940; NAME=Ovis aries musimon; AL=Scaffold; RT=Major
Sequence
MADGGEGEDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPP
DLSICTFVLEQSLSVRALQEMLANTVEKSEGKFMMKTAQGGGHRTLLYGHAILLRHSYSG
MYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVS
SERYLHLSYGNGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGHLDECLTV
PSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTTGKYLS
LMEDKSLLLMDKEKADVKSTAFTFRSSKEKLDVGVRKEVDGMGTSEIKYGDSVCYIQHIN
TGLWLTYQSVDVKSVRMGSIQRKAIMHHEGHMDDGLNLSRSQHEESRTARVIRSTVFLFN
RFIRGLDALSKKVKASTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQN
LFQEEGMINLVLECIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAALIRGNRKN
CAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRN
HKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGVSEGS
AQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGF
DGLHLWSGCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFENFNIDGL
FFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREYKQERTYT
RDLLGPTVSLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIELGWQYGPV
RDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGISDEHAEEKVKKMKLP
KNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNR
RNPRLVPYALLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARAEVCSGTGERFRI
FRAEKTYAVKAGRWYFEFEAITSGDMRVGWSRPGCQPDQELGSDERAFAFDGFKAQRWHQ
GNEHYGRSWQAGDVVGCMVDMTEHTMMFTLNGEILLDDSGSELAFKDFDVGDGFIPVCSL
GVAQVGRLNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQVPSNHEH
IEVTRIDGTIDSSPCLKVTQKSFGSQNSSTDIMFYRLSMPIECAEVFSKTAAGGIPGTGL
FGPKNDLEDYDVDSDFEVLMKTAHGHLVPDRGDKDKEATKPEFNNHKDYAQEKPSRLKQR
FLLRRTKPDYSTSHSARLTEDVLADERDDYDYLMQTSTYYYSVRIFPGQEPANVWVGWIT
SDFHQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESLSPGQGRNNNGLEI
GCVVDAASGLLTFTANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLS
AGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCVEPLQF
MSLHIPEENRSVDILELTEQEELLKFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLLY
AIENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEFIVPMTEETKSITLFPDEKKKHG
LPGIGLSTSLRPRMQFSSPSFVSINTEGYQYSPEFPLDILKAKTIQMLTEAVKEGSLHAR
DPVGGTTEFLFVPLIKLFYTLLIMGVFHNEDLKHVLQLIEPSVFKEAASPEEESEVAEKE
PFVEDSKLEGAAEEENKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVA
FSDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNFKDDKSECP
CPEEIRDQLLDFHEDLMTHCGIELDEDRSLDGNNDLTIRGRLLSLVEKVTYLKKKQAEKP
VESDSKKSSTLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYT
INGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGM
HETVMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSV
GLASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYPD
IGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLSAM
EEAIKIAEDPSRDGPSPTTGSSRTPDTEEEEDDTIHMGNAIMTFYAALIDLLGRCAPEMH
LIHAAKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGNVVEPDMSAGFCPDHKAA
MVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPL
LTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQH
LLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFWG
IFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGNFNPQPVD
TSNITIPEKLEYFINKYAEHAHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPYKLLSEKE
KEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSVDAAHGYSPRAID
MSNVTLSRDLHAMAEMMAENYHNIWAKKKKLELEAKGGGNHPLLVPYDTLTAKEKAKDRE
KAQDILKFLQINGYAVSRGFKDLELDTPSIEKRFAYSFLQQLIRYVDEAHQYILEFDGGS
RSKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKEKEMVTSL
FCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLESVKSALRAFLDNAAED
LEKTMENLKQGQFTHTRNQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQ
VSCYRILTSLYALGTSKSIYVERQRSALGECLAAFAGAFPVAFLETHLDKHNIYSIYNTK
SSRERAALNLPTNVEDVCPNIPSLEKLMEEIVDLAESGIRYTQMPHVMEVILPMLCSYMS
RWWEHGPENNPGRAEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPII
NKVKPQLLKTHFLPLMEKLKKKAAMVVSEEDHLKSEARGDMSEAELLILDEFTTLARDLY
AFYPLLIRFVDYNRAKWLKEPNQEAEDLFRMVAEVFIYWSKSHNFKREEQNFVVQNEINN
MSFLIMDTKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQE
LIALAKNRFSLKDTEDEVRDMIRSNIHLQGKLEDPAIRWQMALYKDLPNRTEDTSDPEKT
VERVLDIANVLFHLEQVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRAVNL
FLQGYEKSWIETEEHYFEDKLIEDLAKPGAEPPEEDEGTKRVDPLHQLILLFSRTALTEK
CKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEVTGSQRSKEKEMEKQKLLYQQARL
HDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDYLKEKKDVGFFQ
SLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHN
SDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDEQGQRNFSKAIQ
VAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKEL
MDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDT
FKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEPA
KDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGSAKRIERVYFE
ISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQISESDL
NERSANKEESEKEKPEEQGPRMGFFSIMTVKSALFALRYNILTLMRMLSLKSLKKQVKKV
KKMTVKDMITAFFTSYWSILMSLLHFVASVFRGFSRIIGSLLLGGSLVEGAKKIKVAELL
ANMPDPTQDEVRGDGEEGERKTLEGALPSEDLTDLKELTEESDLLSDIFGLDLKREGGQY
KLIPHNPNAGLSDLMSNPVPIPEVQEKFQEQKANEEEKEEKEESKSEPEKAEGEDGEKEE
KAKEDKGKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLLNYFARNFYNMRMLALFVAF
AINFILLFYKVSTSSVVEGKELPTRSSSENARVSSLDSSSPRIIAVHYVLEESSGYMEPT
LRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWD
RLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAREKKKPKKD
SSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSILGHYNNFFFAAHLLDIAMGFK
TLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLT
CYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFG
ELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDET
EHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
Download sequence
Identical sequences XP_011980516.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]