SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011980697.1.54773 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011980697.1.54773
Domain Number 1 Region: 373-475,506-751
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 4.05e-111
Family Oxysterol-binding protein 0.0000485
Further Details:      
 
Domain Number 2 Region: 70-181
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-20
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011980697.1.54773
Sequence length 756
Comment PREDICTED: oxysterol-binding protein-related protein 11 [Ovis aries musimon]; AA=GCF_000765115.1; RF=na; TAX=9938; STAX=9940; NAME=Ovis aries musimon; AL=Scaffold; RT=Major
Sequence
MDFGVKMQGGEPVSAMKVSESEGRLEGLATAVTPNKNSGNSGCGGGISSSSSSRGGSAKG
WQYSDHMENVYGYLMKYTNLVTGWQYRFFVLNNEAGLLEYFVNEQSRNQKPRGTLQLAGA
VISPSDEDSHTFTVNAASGEQYKLRATDAKERQHWVSRLQICTQHHTEAIGKNNPPLKSR
SFSLASSGNSPISQRRPSQNTISFFNVGHSKLQSVSKRANLPPDHLVEVREMMSHAEGQQ
RDLIRGIECLPASGHLSSLDQDLLMLKATSMATMNCLNDCFHILQLQHASHQKGSLPSGT
TIEWLEPKIPLSNHYKNGADQPFATEQSKPVAVPEEQCVAESGLLAREPEEINADDEVED
TCDNKEDDLGAVEEQRSVILHLLSQLKLGMDLTRVVLPTFILEKRSLLEMYADFMSHPDL
FIAITNGATAEDRMIRFVEYYLTSFHEGRKGAIAKKPYNPIIGETFHCSWRMPKSEVASS
VINSSSTQAITNHVPPSEEALNQMGSDCYTVRFVAEQVSHHPPVSGFYAECAERKMCVNA
HVWTKSKFLGMSIGVTMVGEGILSLLEHGEEYTFSLPCAYARSILTVPWVELGGKVNVNC
AKTGYSASITFHTKPFYGGKLHRVTGEVKHNITNTVVCRVQGEWNSVLEFAYSSGETKYV
DLTKLAVTKKRVRPLEKQDPFESRRLWKNVTDSLRDSEIDKATEHKRTLEERQRTEERHR
TETGTPWKTKYFIKEGDGWVYHKPLWKIIPTTQPAE
Download sequence
Identical sequences W5QG92
ENSOARP00000021741 XP_004003041.1.66739 XP_011980697.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]