SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011984882.1.54773 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011984882.1.54773
Domain Number 1 Region: 247-499
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.38e-60
Family Eukaryotic proteases 0.0000000277
Further Details:      
 
Domain Number 2 Region: 53-169
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-26
Family Spermadhesin, CUB domain 0.00015
Further Details:      
 
Domain Number 3 Region: 174-254
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000292
Family Complement control module/SCR domain 0.0000546
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011984882.1.54773
Sequence length 503
Comment PREDICTED: LOW QUALITY PROTEIN: complement C1r subcomponent-like isoform X2 [Ovis aries musimon]; AA=GCF_000765115.1; RF=na; TAX=9938; STAX=9940; NAME=Ovis aries musimon; AL=Scaffold; RT=Major
Sequence
MPSGTAIPSPTRQQGSAPLPPYRHLFPFGRWLLYLLLPVLFYGVGGAIPTPQRLYGEVMS
PLFPKPYPNNFERTTVITVPTGYRVKLVFWQFDLEPSEGCFYDYVKIPADKKTLGVFCRQ
LGSPLGNPPGRMEFMSQGNKLLLTFHTDFSNEENGTDIFDKGFQAHHQAMVKDCGQPRSL
PNGAFNYTTREGVNTYEAHIQYCCHEPFYKMHAKDGTSESERGLYTCMAQSIWKNELARE
KMPWCLPVCRKPVHPVEQRQHIIGGQKAKLGNFPWQAYTNIHGPGGGALLGDCWILKAAH
TINPKDLQGQGNVSVDVFLGHXNMEEIIKLSNYPVRRVIIHPDYRQKESHSFERDITLLE
LENSITLGPNLLPICLPDNKTLYDLGLMGYVSGFGIMEKRISHDLRFVRLPAARQETCKH
WLQQKNRNDVFSENMFCAGSPTLKHDVCHGNAGRVSAMRDKKNDRWVATGIVSWSIGCGE
GYGFYTNLLNYMDWIKKEMEVEN
Download sequence
Identical sequences XP_011984882.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]