SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011993765.1.54773 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011993765.1.54773
Domain Number 1 Region: 432-640
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000576
Family MIF4G domain-like 0.09
Further Details:      
 
Domain Number 2 Region: 5-152
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000368
Family APC10-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_011993765.1.54773
Sequence length 925
Comment PREDICTED: centrosomal protein of 104 kDa isoform X1 [Ovis aries musimon]; AA=GCF_000765115.1; RF=na; TAX=9938; STAX=9940; NAME=Ovis aries musimon; AL=Scaffold; RT=Major
Sequence
MPHKIGFVVVSSSGHEDGFSARELMIHAPTVSGWRSPRFCQFPQEIVLQMVERCRIRKLQ
LLAHQYMIPSKVEFYISESLPEYFTPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVDA
VGQFLKLIFHQNHVNKYNVYNQVALVAVNIIGDPADFGDETNITSREKLIDHYLGHNTED
PALEGTCSGKSDYISPLDDLAFDMYQDPEVAQIIRRLDERKREAVQKERYDCAKKLKQAI
ADLQKVGERLGRYEVEKRCAVEKEDYDLAKEKKQQMERFRSRVYEQLQLHELVDAELMRR
PLDLPLQPLACPSSPHHQPPMHSLPQPEERVTENRLVDPFLQEKPSSHCLDVSSQRPTVD
RPPPATDPPPRTHPESLPYDERPLPVTRKQLGAAVSEAERRDMLGDEARRADAAGEPEPL
TEKALREASSAVDVLGEALVAGAYSKTWSHREDALLTLHKQLADTPVGTPKEDLKSMLRA
AVFLVRRAIRDIVTPVFQASLKLLKMIITQYIPKHKLGRLETAHCVERTIPVLLTRTGDS
SARLRVMASNFIQEIALFKEVKSLQVIPSYLVQPLKANSSTHLAMSQMALLARLLRDLGT
EGAGFTVDSVMRFSVQALEHRVREVREAAVGMILDLYAQHRALVLEYLPPDDSATRRNVL
YKTIFEGFAKIDGRPTDAEMRAQKRAAAEEAEKRKKEEIKALQGQLAALKEMQAGVQEKE
SEATKAKNQDTQERKVARPNAPEIPDNHYLDNLCIFCGERSESFTEEGLDLHYWKHCLML
TRCEHCRQVVEISSLTEHLLTECDRKDGFGRCYRCSEAVSKEELPRHVKTRDCNPAKSEK
LANRCPLCHENFSPGEEAWKAHLMGPAGCTMNLRRTHVLHKTPVLPPGKGPAATRAGTSG
SKVGSKIPTPKGGLSKISSRTYTKR
Download sequence
Identical sequences XP_011993765.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]