SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_011994754.1.54773 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_011994754.1.54773
Domain Number 1 Region: 66-256
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.77e-52
Family Astacin 0.00014
Further Details:      
 
Domain Number 2 Region: 426-592
Classification Level Classification E-value
Superfamily TRAF domain-like 2.78e-33
Family MATH domain 0.0014
Further Details:      
 
Domain Number 3 Region: 264-427
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.22e-30
Family MAM domain 0.0013
Further Details:      
 
Weak hits

Sequence:  XP_011994754.1.54773
Domain Number - Region: 605-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000401
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_011994754.1.54773
Sequence length 700
Comment PREDICTED: meprin A subunit beta isoform X1 [Ovis aries musimon]; AA=GCF_000765115.1; RF=na; TAX=9938; STAX=9940; NAME=Ovis aries musimon; AL=Scaffold; RT=Major
Sequence
MTSWDLPWFLCSAALLSVSGLPTPEIFDVDNGLDRDIFDINEDLGLDLFEGDIMLDEMQE
RNAIVGERYRWPHTIPYVLDDSLEMNARGVILKAFERYRLKSCIDFKPWSGEPSYISVFK
GNGCWSSVGKQFTGMQQLSIGEGCDKIATVQHEFLHALGFWHEQSRSDRNDYVSIIWNRI
ISGKERNFDFYDDQVIDSLNVPYDYSSVMHYSKTAFGNGSEPTIVTRVPDFMDVIGQRMD
FSDSDVLKLNQLYNCSSSLSFMESCDFELENVCGMIQSSADSADWQRLSQVSQGPESDHS
NMGRCRGSGFFMHFNCSSVNEGATAILESRILYPKRGFQCLQFFLYNSGSKDDQLNIYIR
EYSAAHPSRTVSLVEQIKDIPSGSWQLYHVTLNATSKFRVVFEGVRGAGASLGGLSIDDI
NLSETRCPHHVWHIRNFTQLIGSPDGSFYSPPFYSSKGYAFQIYLDLYSLPKIGMYFHLI
SGANDDQLEWPCPWQQVTMTILDQTPDIRQRMSNQQSLTTDPFLTIDNGNYFWDRPSKVG
AQVIFPNGTQFQRGRGRGFHNFMTQELLKSRDFIKGDDVYILLTMEDISHLNTQNDPLPT
LDVNDLCTSFRCENDGICILQNGKAECRCRSGDDWWYMGERCEKRGSTRDTIVIATSSTA
AVFALMLIVTLVSIYCTRKKYRKEPSSRTVNTIMENQYAL
Download sequence
Identical sequences W5P7X2
XP_004020496.1.66739 XP_011994754.1.54773 ENSOARP00000006526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]