SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012004614.1.54773 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012004614.1.54773
Domain Number 1 Region: 123-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-17
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 2 Region: 99-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000139
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012004614.1.54773
Sequence length 193
Comment PREDICTED: zinc finger protein 740 isoform X1 [Ovis aries musimon]; AA=GCF_000765115.1; RF=na; TAX=9938; STAX=9940; NAME=Ovis aries musimon; AL=Scaffold; RT=Major
Sequence
MAQASLLACEGLAGVSLVPTAASKKMMLSQIASKQAENGERAGSPDVLRCSSQGHRKDSD
KSRSRKDDDSLAEASHSKKTVKKVVVVEQNGSFQVKIPKNFVCEHCFGAFRSSYHLKRHI
LIHTGEKPFECDICDMRFIQKYHLERHKRVHSGEKPYQCERCHQCFSRTDRLLRHKRMCQ
GCQSKTSDGQFSL
Download sequence
Identical sequences G3MZB2
9913.ENSBTAP00000021935 ENSBTAP00000054908 XP_004006360.1.66739 XP_004429154.1.5094 XP_005954389.1.78601 XP_006046683.1.26621 XP_006182514.1.101512 XP_010856202.1.44457 XP_010962659.1.22495 XP_010984930.1.51371 XP_012004614.1.54773 XP_015093677.1.17985 XP_017903182.1.57651 XP_019816045.1.53367 XP_020750718.1.74333 ENSBTAP00000054908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]