SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012009300.1.54773 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012009300.1.54773
Domain Number 1 Region: 180-251
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000486
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 2 Region: 240-300
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000153
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 3 Region: 127-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000128
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 4 Region: 75-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000102
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 522-626
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000559
Family Fibronectin type III 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012009300.1.54773
Sequence length 752
Comment PREDICTED: sushi domain-containing protein 1 isoform X1 [Ovis aries musimon]; AA=GCF_000765115.1; RF=na; TAX=9938; STAX=9940; NAME=Ovis aries musimon; AL=Scaffold; RT=Major
Sequence
MARGPWGVCIPLGRLLLLLLLLSLARGAPRSWSQDDFHSDICATCHEHATCLKRERMSIC
ICKYGFVGNGRTHCIDKDECQFGASVVCGNHTSCHNTPGGFYCICLEGYRATNNNKTFIP
NDGTYCTDIDECEVSSRCRYGGRCVNTRGSYECYCMDGYLPKGGPVPFHPTRDATLCTEI
DCGTPPEIPGGYIIGNYTSRLGSQVHYACKEGFFSDSEDTVSSCTAMGTWDSPKLNCQEI
DCGHPPEVQHAILEGNHSSRLGSVAHYVCLEGFESPGGKITSVCTEKGTWRASASSCSEI
IVEINEVSVFNNTCVRWQINPGRINSKIEYVIHIKGQRLDPLESVHEETVNLTTESRTPE
VCLDLYQGTNYTVNISTAPPRRSVPAVIEFQTAGDDLLEDDGIFNISIFNDVCLKLNRHS
RKVGSEQVYQFKVLGRRRYLNTFYHATSFNFTTREQTAVVCLDLYPATDYTVNVTLLGSP
EWPSVQTTVTTVPAVQQTISNISIFNETCLRWRSMKTADIEEMYLVHIWGQRWYQKGFAQ
EMIFNITASSQTPETCLDLSPGTNYSVSIQALSSELPVVISLTTQITEPPLPEVDFFTVH
GGPLPRLRLRKATEKNGPISSYQVLVLPLALQSTFACDSEEAASFFSKASEASGYVTAEL
LAKDIPDDALEIPIGDRLYYGKYYNAPLKTGHDYCIILRITSEWNEVRRRACAVWAHVKG
SSLTLSLPQVLGVGLGSVAVVIVLASLSFSAV
Download sequence
Identical sequences XP_012009300.1.54773 XP_012009301.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]