SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012015727.1.54773 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012015727.1.54773
Domain Number 1 Region: 136-312
Classification Level Classification E-value
Superfamily Sec7 domain 7.33e-46
Family Sec7 domain 0.0000983
Further Details:      
 
Domain Number 2 Region: 62-139
Classification Level Classification E-value
Superfamily F-box domain 5.76e-16
Family F-box domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012015727.1.54773
Sequence length 319
Comment PREDICTED: F-box only protein 8 [Ovis aries musimon]; AA=GCF_000765115.1; RF=na; TAX=9938; STAX=9940; NAME=Ovis aries musimon; AL=Scaffold; RT=Major
Sequence
MGQGLWRVARNQQLQQEGYGEQGYFSREQSRRVAASNMSHTSHRKHVQGGIDIYHLLKTR
KSKEQEGFINLEMLPPELSFTILSYLNATDLCLASCVWQDLANDELLWQGLCKSTWGHCS
IYNKNPPLGFSFRKLYMQLDEGSLTFNANPDEGVNYFMSKGILDDSPKEIAKFIFCTRTL
NWKKLRIYLDERRDVLDDLVTLHNFRNQFLPNALREFFRHIHAPEERGEYLETLITKFSH
RFCACNPDLMRELGLSPDAVYVLCYSLILLSIDLTSPHVKNKMSKREFIRNTRRAAQNIS
EDFVGHLYDNIYLIGHVAA
Download sequence
Identical sequences W5Q174
XP_004004503.1.66739 XP_011984646.1.66739 XP_012015727.1.54773 XP_012015728.1.54773 ENSOARP00000016460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]