SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012021050.1.54773 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012021050.1.54773
Domain Number 1 Region: 250-440
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.96e-29
Family Laminin G-like module 0.049
Further Details:      
 
Domain Number 2 Region: 1526-1600
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000584
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 685-830
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000733
Family Matrix metalloproteases, catalytic domain 0.083
Further Details:      
 
Domain Number 4 Region: 538-637,722-773
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000044
Family Zinc protease 0.079
Further Details:      
 
Domain Number 5 Region: 1592-1649
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000709
Family Complement control module/SCR domain 0.0045
Further Details:      
 
Domain Number 6 Region: 1466-1536
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000032
Family Complement control module/SCR domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012021050.1.54773
Sequence length 1780
Comment PREDICTED: pappalysin-2 isoform X2 [Ovis aries musimon]; AA=GCF_000765115.1; RF=na; TAX=9938; STAX=9940; NAME=Ovis aries musimon; AL=Scaffold; RT=Major
Sequence
MMCFKILRVSLVVLAGWALSTVSSELGWTRKRSLAQRGYLNQVLSEGERCWLGAKVRRPR
VAPQHHLFGVYPSLPGDYLRPYPAGDQGRAHVRCSEPDAGGMVVSSVPPDPTASARKRSE
AEQPAAPWGGDSTIGQSELLGDDDTYLGDGGSKEPLGEAGTPEGTALAATVITSFPCPKE
SGPDTQRKGRTKTRRRRQVVKGQAGGLRGDPEFAPQHFQPWPKHPLTPRDRTGPSEGGIR
NGGGDPSWEAETETVSPQGGLPVLYFSGRREPLLLRPEVLADIPREAFTVEAWVKPEGGQ
NSPAIIAGVFDNCSHTISDKGWALGIRSGKDVGRRDARFFFSLRTDRVKKATTVMGHSRY
QPGKWTHLAATYDGQRMALYVDGTQVASSRDQSGPLNSPFMASCRSLLLGGDSSEDGHSF
RGHLGTLVFWSTARPQSHLQHRPQQPLEVKDLTTLLLTASFEPLEEQWVPFRDGKYPRRE
VLQGFESKPEILSPLQPPLCGQTACDNVELISQYNGHWPLRGEKVIRYRVVNIYDDKGLN
PTVSEEQIRRQHEVLNEAFSRYNISWQLSVHRVHNSTLRHRIVLVNCEPSKIGNDHCDPE
CEHPLTGYDGGDCRLQGRCYSWNRKDGLCHVGCNNMLNDFDEGDCCDPDVTEVRKTCFDP
DSPRRAYMSVKELKEALQLNSTHFLNVYFASSVRENLAGAATWPWDKEAISHLGGVVLNP
AYYGMPGHTNIMIHEVGHVLGLYHVFKGVSERESCDDPCRETVPSMETGDLCADTAPTPK
SKLCQNPEPANDTCGFTYFPGAPFNNYMSYTDDDCTDSFTPNQVARMHCYLDLVYQQWSQ
SQKPTPIPIPPMVIGQTQKSLTIHWLPPISGVMYDRVPGSMCGACTEDGTFRQYVHTASS
QRVCDSSGYWTPEEAVGPPDVDQPCEPSLQAWSPELHLHHTNMTVPCPAEGCSLELLFQH
PVQADTLTLWVTYLSMGSSPVLFDTEILLEHQKSVHLGPLDTFCDTPLTIKLHVDGKVMG
VKVYTFDERMEIDAALLTSQPHSPLCSGCRPVSYQILREPPFASGLPAAVMHPHRKFTDM
EVMPGQMYRYQVQAAAEAELGEASPPLSHIHGAPYCGDGKVARNLGEECDDGDLLNGDGC
SRACELEEGFNCVGEPSLCYIHEGDGICEPFEKETSIVDCGLYTPKGYLDQWATQAFASH
EDTKKCPVSLVTGAPHSMVCTSYRPDLPEHRPLTGWFPCVPSGNRSQDEGSKQPKGSLKR
EDEVWLKVCFSRPGVATAIFIFLTSDGLVSGKRQRPTVTLYLTDVSGNNHSLGTYELSCQ
HNPLVINITHHSNVLFHHATSVLLNFSTPLVGISAVALRTSSDTSPSAPNSCIIPEQKGQ
NHQGQSCVHRPCGEQGSCVPLLLDHADMVNCTSGGPGLMKCSITCQRGSALQASNGQYLR
PMQKKILLTCSSGHWDRAVSCQPLDCGVPDASLVNYANFSCLEGTNFLKRCSISCIPPAK
LQGLSPWLTCLEDGLWSLPEAYCKLECDAPPVIPNANLLQPRCLQGNHDVGSTCRYECKP
GYYVLGSTENKVRNKSLKIQCLESGIWEQGSCVPVVCEPPSPVFEGMYECTNGFELDSQC
FINCNQESKRLPIRCTKEGRWSEEFKLCENLRGECPPPTSDPKFVEYKCEQGHGIGAVCS
PLCIVLPSDPVILPENITTDTLEHWMEPVRVQSVMCTGRRQWHPDPLLIHCIQSCEVRYS
PSLKPRPALSALLNSQRFESFWFSILPFLCSDALCSVSYT
Download sequence
Identical sequences XP_012021049.1.54773 XP_012021050.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]