SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012022259.1.54773 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012022259.1.54773
Domain Number 1 Region: 360-576
Classification Level Classification E-value
Superfamily L domain-like 1.7e-35
Family Ngr ectodomain-like 0.012
Further Details:      
 
Domain Number 2 Region: 39-262
Classification Level Classification E-value
Superfamily L domain-like 1.07e-34
Family Ngr ectodomain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012022259.1.54773
Sequence length 696
Comment PREDICTED: SLIT and NTRK-like protein 1 [Ovis aries musimon]; AA=GCF_000765115.1; RF=na; TAX=9938; STAX=9940; NAME=Ovis aries musimon; AL=Scaffold; RT=Major
Sequence
MLLWILLLETSLCFAAGNVTGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQRFTAPTSQF
YHLFLHGNSLTRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKRLHINNNKIKS
FRKQTFLGLDDLEYLQADFNLLRDIDPGAFQDLNKLEVLILNDNLISTLPANVFQYVPIT
HLDLRGNRLKTLPYEEVLEQIPGIAEILLEDNPWDCTCDLLSLKEWLENIPKNALIGRVV
CEAPTRLQGKDLNETTEQDLCPLKHRVDSSLPAPPAQEETFPPGPLPTPFKTNGQEDHAT
PGSAPNGGTKIPGNWQIKIRPTAAIGTGSARNKPPANGLPCPGGCSCDHIPGSGLKMNCN
NRNVSSLADLKPKLSNVQELFLRDNKIHSIRKSHFVDYKNLILLDLGNNNIATVENNTFK
NLLDLRWLYMDSNYLDTLSREKFAGLQNLEYLNVEYNAIQLILPGTFNAMPKLRILILNN
NLLRSLPVDVFAGVSLSKLSLHNNYFMYLPVAGVLDQLTSIIQIDLHGNPWECSCTIVPF
KQWAERLGSEVLMSDLKCETPVNFFRKDFMLLSNDEICPQLYARISPTLTSHSKNSTGLA
ETGTHSNSYLDTSRVSISVLVPGLLLVFVTSAFTVVGMLVFILRNRKRSKRRDANSSASE
INSLQTVCDSSYWHNGPYNADGAHRVYDCGSHSLSD
Download sequence
Identical sequences F1MJJ9 W5Q6R2
XP_005907346.1.15283 XP_005977847.1.78601 XP_010853004.1.44457 XP_010853005.1.44457 XP_010853006.1.44457 XP_012022259.1.54773 XP_012040227.1.66739 XP_015321221.1.59421 XP_015329358.1.76553 XP_017911946.1.57651 XP_019827436.1.53367 ENSOARP00000018403 ENSBTAP00000049290 ENSBTAP00000049290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]