SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012035077.1.66739 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012035077.1.66739
Domain Number 1 Region: 687-1043
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.05e-112
Family Hect, E3 ligase catalytic domain 0.000000155
Further Details:      
 
Domain Number 2 Region: 2-380
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.31e-101
Family Regulator of chromosome condensation RCC1 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012035077.1.66739
Sequence length 1050
Comment PREDICTED: probable E3 ubiquitin-protein ligase HERC3 isoform X1 [Ovis aries]; AA=GCF_000298735.2; RF=representative genome; TAX=9940; STAX=9940; NAME=Ovis aries; breed=Texel; AL=Chromosome; RT=Major
Sequence
MLCWGYWSLGQPGISPNLQGVVAEPQVCGFISDRSVKEVACGGNHSVFLLEDGEVYTCGA
NTKGQLGHEREGNKPEQIGALADQHIVHVACGESHSLALSDQGQLFSWGAGSDGQLGLMT
TEDSVAVPRLIQKLNQQTILQVSCGNWHCLALAADGQFFTWGRNSHGQLGLGKEFPSQAS
PQRVRSLEGIPLAQVVAGGAHSFALSLSGAVFGWGMNNAGQLGLSDEKDRESPCHVKLLR
TQKVVYISCGEEHTAVLTKSGGVFTFGAGSCGQLGHDSMNDEVNPRRVLELMGSEVTQIA
CGRQHTLAFVPSSGLIYAFGCGARGQLGTGHTCNVKCPSPVKGYWAAHSGQLSARADRFK
YHIVKQIFSGGDQTFVLCSKYENSSPAVDFRTMNQAHYTSLINDETIAVWRQKLSEHNNA
NTINGVVQILSSAACWNGSFLEKKIDEHFKTSPKIPGIDLNSTRVLFEKLMNSQHSMILE
QILNSFESCLIPQLSSSPPDVEAMRIYLILPEFPLLQDSKYYITLTIPLAMAILRLDTNP
SKVLDNWWSQVCPKYFTKLVNLYKGAVVYLLRGRKTFLIPVLFNNYITAALKLLEKLYKV
NLKVKHVEYDAFYIPEISSLVDIQEDYLMWFLHQAGMKARPSIMQDAVTLCSYPFIFDAQ
AKTKMLQTDAELQMQVAVNGANLQNVFMLLTLEPLLARSPFLVLHVRRSNLVGDALRELS
IHSDIDLKKPLKVIFDGEEAVDAGGVTKEFFLLLLKELLNPIYGMFTYYQDSNLLWFSDT
CFVEHNWFHLIGITCGLAIYNSTVVDLHFPLALYKKLLNVKPGLEDLKELSPTEGRSLQE
LLDYPGEDIEETFCLNFTICRESYGVIEQKKLIPGGDKVAVCKENRQEFVDAYVNYVFQI
SIHEWYTAFSSGFLKVCGGKVLELFQPSELRAMMVGNSSYNWEELEETAIYKGDYSATHP
TVKLFWETFHEFPLEKKKKFLLFLTGSDRIPIYGMASLQIVIQSTASGEEYLPVAHTCYN
LLDLPKYSSKEVLRARLTQALDNYEGFSLA
Download sequence
Identical sequences W5NPL0
ENSOARP00000000100 XP_004009758.1.66739 XP_012035077.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]