SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012047652.1.45702 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012047652.1.45702
Domain Number 1 Region: 111-206
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.91e-18
Family Selenoprotein W-related 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012047652.1.45702
Sequence length 218
Comment selenoprotein W [Cryptococcus neoformans var. grubii H99]; AA=GCF_000149245.1; RF=na; TAX=235443; STAX=5207; NAME=Cryptococcus neoformans var. grubii H99; strain=H99; AL=Chromosome; RT=Major
Sequence
MPENCKDCDQYPTQPASSTAMSRGVIAPECSLPGADVASPLSLSYVSSQTQAQDQTEVQP
RLKVGAGEAKVEGLENKDEGTGTSTPSASASATVAMLAGQGFKAPDLREVKPSVIIEFCD
RCRWAPRATWIQTELFLTFPNPILRSITLMPLNAPETGGRFRVWVDVGKGMGDELAWDRK
TEGGFPELKVLKQRIRNLVQPDMGLGHSDVHGKTGEAK
Download sequence
Identical sequences J9VHB6
XP_012047652.1.45702 CNAG_04063T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]