SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012048225.1.45702 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012048225.1.45702
Domain Number 1 Region: 24-132
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.42e-27
Family PDI-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012048225.1.45702
Sequence length 388
Comment protein disulfide-isomerase [Cryptococcus neoformans var. grubii H99]; AA=GCF_000149245.1; RF=na; TAX=235443; STAX=5207; NAME=Cryptococcus neoformans var. grubii H99; strain=H99; AL=Chromosome; RT=Major
Sequence
MKLDWFAVITAVLLPLSAYAGMYSQPVLHLDSKTFKSVMANEHAAMVAFVAPWCGHCKNL
GPEYTAAAQSLSPLIPFYAVDCDESSNRGLCAEYGVQGYPTIKGFPKAGKGAAKEYNGER
KRGALVEYAKGLVPERVKKLRVQGDIQSDVQGFLGEKSELPHVLLVHPSSPSIPFLWKVL
AHRFSNKLHLGYVRDTTSHDVLSLLGIYDSADTTRDSTRVVAWSPGSQRGEFVEYDGILK
FNALLEWLQTTFTSAAPSNTKQRPIKAPQPTVKSTNKEKEQIPTQAQNDAAARRAKLEEM
ERRDKARREKAAEAARAQAMATEPEPETEKEATPVEDAADAAPAQVIEDASLPMEEVESK
PVPEEAPDDEASARDVEVEKTEVVHEEL
Download sequence
Identical sequences J9VPY2
CNAG_02927T0 XP_012048225.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]