SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012049194.1.45702 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012049194.1.45702
Domain Number 1 Region: 4-75
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000824
Family Glutathione S-transferase (GST), N-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 160-236
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000156
Family Glutathione S-transferase (GST), C-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012049194.1.45702
Sequence length 249
Comment glutathione transferase [Cryptococcus neoformans var. grubii H99]; AA=GCF_000149245.1; RF=na; TAX=235443; STAX=5207; NAME=Cryptococcus neoformans var. grubii H99; strain=H99; AL=Chromosome; RT=Major
Sequence
MPHQIILHHLNNSRSDRIFWTLEELNLPYDVQVHFRLPTRSAPPSLHKVSPLGRAPALIL
DGRLLTESAYIIHTLLSLPEVQQAAQKGEIDVQVENTNDDVFWSHFAEASMMNLLQGMAT
VGATSQGWLSGKVPGLPELSEDEKKGIQKYSSWVQDGYFRPNIQSPIDFAENFLAKQDAP
FFSGTSKPGEGDFMMFFAINSLLGGSRADMGFKVGPNLKKWYDIVLSRPAGKKALERLKQ
EEESAKAKI
Download sequence
Identical sequences J9VLS0
CNAG_00921T0 XP_012049194.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]