SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012051681.1.45702 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012051681.1.45702
Domain Number 1 Region: 26-111
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.68e-16
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012051681.1.45702
Sequence length 150
Comment hypothetical protein CNAG_04235 [Cryptococcus neoformans var. grubii H99]; AA=GCF_000149245.1; RF=na; TAX=235443; STAX=5207; NAME=Cryptococcus neoformans var. grubii H99; strain=H99; AL=Chromosome; RT=Major
Sequence
MPRLVPPFSSFPKTQPVQGYKHFLTPLRKLIFDYDAEAPSQHGIRSYIRKPLLDMARENP
DVEIVVRRLKRGKAAVLRGHYVNGRDKVICVNKLEANEVANKVDLLLNSSGAKIKHLKNL
TLEAAPGAESARGIWSALHDKTRDGKGYQI
Download sequence
Identical sequences J9VR95
CNAG_04235T0 XP_012051681.1.45702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]