SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_012139096.1.71094 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012139096.1.71094
Domain Number 1 Region: 573-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000118
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 144-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000106
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 317-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000134
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 490-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000105
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 5 Region: 627-688
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000457
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 544-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000126
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 7 Region: 431-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000036
Family Classic zinc finger, C2H2 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012139096.1.71094
Sequence length 1091
Comment PREDICTED: zinc finger protein 91 [Megachile rotundata]; AA=GCF_000220905.1; RF=representative genome; TAX=143995; STAX=143995; NAME=Megachile rotundata; AL=Scaffold; RT=Major
Sequence
MDVAGDLTLQWVEEVGNVIHEEVICGLEAQLVGAEEEVIGACEEVAVEETVETVPDVAPT
TESEILMVPQSNDMESIYIVPQDQGHDYLNIQVTEEVIADNWDRSGPEDGVEISETKVSH
ENLLEYDDMEIPLPIDQDSYTNSRPYPCDFCSRRFRKKANLMNHMVAHQTDRPHGCNLCG
ARYARKCDLMNHLKIHAYAPSRDGLEDDLNDDDSLVPEEEESTKGRRKKVQSSVPRKRKN
HSAISKRSMDDNKMEMGKYVNKSYDYVDEDMRLLEEMTSRNSARSSNYASSSRWNDQMSP
VSTEPQAPRWPITDPTKPYVCQYCGVGFAREKALASHARIHGGDSPFECTTCGDMFWDVN
ILREHVRVKHGGTAQSDMDEYDNDATYTGDERFGEFYCNTCGVPFHRLDLLKRHQKIHVK
QEADMMEGPSQHHVCNVCGEWFEEALALLAHAELHARSPSRRCLLCGERCRDDAEVAEHV
RQNHAEDAPPNTCTLCGKTCKDKRSLLKHSWVHNVDKTFGCTKCGKRFHSKARLRRHMVS
HRNKMVACDECGEEFPDGRALVSHRHSHNKELGGRSFPCRECGKTFGSRSSQQIHIRIHT
GERPYGCRFCWKAFADGGTLRKHERIHTGEKPYGCAICPRAFNQRVVLREHVRAHHSGPD
PKCVGSITPYLCKVCGDAYGTSEEIVAHIVQHCDDNTALRRQPQTGPRKYKRRRKLKPHE
TNTMLRMNEQYDMMEAGSDSDDNTKRKLGRKNKQHRSNIEEGYQNVLKSFESSLQNINSI
VSNSKLNPGKSKLSKKKLRKEEKKSESQASCHPGRPKMIHTQKTRVPVEIGSDGVKRGQK
TKTMVTRTPKMMPQEHKLGIFPGGERNRPRTKNVSYHIEGKFQPSAATFPKPKDEIPRTP
TPTLQQLPITHIKLEPNLQKTPNNNHRNNNGNILGMNNEKMESSGRKKSGVLKKIKKQKD
GIKQEPMDIDQDEIQNNNNTESTSPERLMEHTVDGNNLEVAFEASVTTEEENILPDVGEV
NNAEDVGTGNVKLSVKVESTPQRMLAVHSVIAPVDDIPETIIPDAVEYTCEMCSAVFSSR
AELLVHVPIHI
Download sequence
Identical sequences XP_012139095.1.71094 XP_012139096.1.71094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]