SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012150550.1.71094 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012150550.1.71094
Domain Number 1 Region: 812-1027
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-57
Family DBL homology domain (DH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 78-195
Classification Level Classification E-value
Superfamily BRCT domain 1.96e-17
Family DNA ligase 0.086
Further Details:      
 
Domain Number 3 Region: 214-262
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000989
Family DNA-repair protein XRCC1 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012150550.1.71094
Sequence length 1135
Comment PREDICTED: protein ECT2 isoform X7 [Megachile rotundata]; AA=GCF_000220905.1; RF=representative genome; TAX=143995; STAX=143995; NAME=Megachile rotundata; AL=Scaffold; RT=Major
Sequence
MEEQSVHSSISDINSEEAVRNESVIIPRKKRICLIGAAGDDPALGAAAQQFNVPVLKSKT
GLEYVEDTAYCTYFILKSFEGPEYDALHKSAHRILGPTALLQLTERKDSLPSINRPMYTQ
AMVGTVVVFTGFRKKDELTKLINMIHNMGGSIRKEMGAKVTHLIANCCGGDKYRYAVTFR
VPIMSMEWVIALWNAKDDISNYGNNEELIATYKLKPFFGAKVCFFGFPEEEKRHMCEVLQ
QQGGESTEIDDPNCTHVVTHIGSHQYKKSNFSASDMLPCTKNPNYTPHHYTETKPFSFTF
YNPYTHTIPNEKKVGPSYTCNSRCFNFIKKQSSRHLSCNFCSLIHQYVECKENVCNHSIL
DDISQDSDIYIDDNLNDYLSFPDESHNTSKLSISQTDSGIDMSTTKSNFNITPTNDLTAL
KRTNVLIPSTLLGKYPTFTSSLDYNNKRIGNIVSDIALNEYKNINNGNIHTQSEFYNFKS
STLCKKKITRYMNNHCSGGTAHLLKFCKSTQCLHNSFFLSKKITTPRRYVKCKAKSYVNI
HRITSSDKFKFKKIHSHPNLVGQYGSELNDPLLHSSHTKMKRNNFNQLNFSPALKQYDLV
SHQISEIQQRQIYTPLPSPLPVLAKVAEISKSKHGSRNIFASDGKYSNVSSKHCPLKGDD
LKLEKQDDKTLPLVVDESNVNALPDLASVRAHIVKAEWFWTSVQNEGAADEKEYLFEDYL
ESVLSPTVTARRDSQQAVTPSTASTRRKRKRLAETLSSLVQNGTDSPALHKRRSSISDAG
HLSVSGSFLDCTTSPEKPLLDDIPEVEAVNTDNTRKNLSPRHQVFLELVQTESNYVGILS
TIMTLFKSPLEDLIDTSGELLNGTEAKIIFGNFPPIYEVHKKMLEELRYSATYWMEDISI
GNIFLKFAPDLVKAYPPYVNFFENTKEMLDQCDQNKPRFHAFLKVCQTKPECGRQSLKEL
LIKPVQRLPSISLLLNDILKHTNKNNPDHSALELSISSIKEVMTYINEDKRKTEGQLVMF
DIFNEIDNCPPHLVSSHRSFIGKCDVMELSEGLSGRGDHLVLFLFTDTLEICKKRSKAFN
SLKTPNTANGLHTTKLSQGKPYKHIKMLSLSTIKKVVDIRETDVEQKTRALIHCL
Download sequence
Identical sequences XP_012150550.1.71094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]