SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012161697.1.71379 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012161697.1.71379
Domain Number 1 Region: 950-1097
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.1e-38
Family Toll/Interleukin receptor TIR domain 0.0000857
Further Details:      
 
Domain Number 2 Region: 119-265,422-512
Classification Level Classification E-value
Superfamily L domain-like 1.63e-26
Family Ngr ectodomain-like 0.051
Further Details:      
 
Domain Number 3 Region: 718-847
Classification Level Classification E-value
Superfamily L domain-like 4.08e-18
Family Ngr ectodomain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012161697.1.71379
Sequence length 1128
Comment protein toll-like [Ceratitis capitata]; AA=GCF_000347755.2; RF=representative genome; TAX=7213; STAX=7213; NAME=Ceratitis capitata; AL=Scaffold; RT=Minor
Sequence
MNCWFKSESVNFKFNSDNFFIEIICTDESLDINKSLEKVPKFEMPTRAMFSLRKCLQLPD
ILKRNDVIYDAVIIAIESMPMSLLHNSSGIESLTVKSYIPISPIFFLHLKSLRSLTFEIL
VNYLDADRPVYLTTDHFQNLTDLENVTITYTFSNSFPANIFSSLAELQQLSLQNNELSEI
QESSFAAQEKLISLDLSRNFLKYLPDKLFENTSSLRYLYLSENYFSNPSIIIACTKPLAY
LNGLDLSHNKLRTITGNDSHVNETLLTNFEQLKDFASPLSNKNHSGESERRHFIWLDLSF
NPIKIFNTNWYNKMRTKLPIITILPSNKKEYRYLALSLFDARPPYKRQFYYAADPQECYK
SLYTVRYMQANILEATGVCRWLPDYGKCEYVWNAAMLYIDCSSRNMTEFTQLTSPSHFGV
KYANLDISYNKLSELPEATTIAYLDVIQLNASHNQLTVIRSTQLPSNLGMLDVSNNQMAH
LSPALLHRYMLRDQAVTRLFLRGNPWRCDCSAEHLMFAVKAFRSHIFDADQMHCVNEPTR
GVLDLTYASICPENTSILFIQGATAYSASNTTKCHEKYKSGQFKCCVDSMQCSFRDKSGW
VDFELNSSNLFMRIKCLKKQWDVNKILEQLPKFEMPTTAKFSLKTCQHLPDILKRNDVIY
DAEIMAMEPTPMNLLHNSSGIESLKVKSYMPISPTFFLHLKSLRNLKVEILVNYLGSDKL
GYLTTEHFQNLTALKNLTITSTFSKSFPAHIFSSLGELEHLSLQYNNLSELQENSFAAQE
KLISLDLSWNLLEYLPEKLFENTSSLRYLYLSENYFSNPSIIIACTKPLGYLNQMDLSHN
KLRTIGGNDSYVNETILTNFERLEDFTPPLSNKNHSGENERRHFIWLDLSFNPIKIFNTN
CIKESIFSPVYIGVSSAAILTLILIGLSLKYSLQLRIWLHSHNICRRFINESELDKKKNF
DAFISYAHQDEQFVNKTLLPGLEKGPTPFRICTHERNWLAGAYIPEQIIESVEQSSRTII
VLSQHFIESDWARMEFRMAHQSSLIEGRPRLVIIKYGEIVKSNLLDRELRAYLSMTTYLD
WKDERFWHKLRYAMPHKKGEARDADMLETGRKYVIGEMELNGPCTARN
Download sequence
Identical sequences XP_012161697.1.71379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]