SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012162995.1.71379 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012162995.1.71379
Domain Number 1 Region: 129-578
Classification Level Classification E-value
Superfamily Sema domain 2.22e-128
Family Sema domain 0.0000435
Further Details:      
 
Domain Number 2 Region: 1425-1553,1762-1923
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.26e-42
Family p120GAP domain-like 0.052
Further Details:      
 
Domain Number 3 Region: 581-632
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000445
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 4 Region: 1009-1097
Classification Level Classification E-value
Superfamily E set domains 0.0000000000812
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.053
Further Details:      
 
Domain Number 5 Region: 1116-1198
Classification Level Classification E-value
Superfamily E set domains 0.0000000266
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.045
Further Details:      
 
Domain Number 6 Region: 928-1012
Classification Level Classification E-value
Superfamily E set domains 0.0000000882
Family Other IPT/TIG domains 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012162995.1.71379
Sequence length 1980
Comment plexin A3 isoform X2 [Ceratitis capitata]; AA=GCF_000347755.2; RF=representative genome; TAX=7213; STAX=7213; NAME=Ceratitis capitata; AL=Scaffold; RT=Minor
Sequence
MRFIIWLVLAIVLHNLNSIESINTQTRHVEISSKIRDNCYKSTEIYARSLRNVVHIRKAA
LLNAEEDVAESSDGIIDGFKSASLKSALSGSDGGLSSSSIPFFGEEIRDYNANSVSSDAR
NFSNIITNVIHFDTPLNHLVVDTVTGRVFVGGVNYLYQLSPDLELHETVKTGPKNDSVEC
TVLDCPAHAARKPTDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSIVEQDVPDAV
VANDASSSTVAFIAPGPPQPPTTYVMYVGVTYTNNSPYRSEIPAVASRSLEKTKMFQIAS
SAVTTGTRTFINSYAREGYLINYVYGFSSERFSYFLTTQLKHNYHSSPKEYITKIVRICQ
EDSNYYSYTEIPVDCITGGTKYNLVQAGYLGKPSVDLAGSLGITVQDDVLFAIFSVGDGN
ESTDNSALCIYSLKSIRRKFMQNIKSCFNGVGSRGLGFISPNMPCVPTKLQTIGEDFCGL
DVNSPLGGEQPISVVPVAKFNTQLTAVAATSTSGYTVVFIGTANGHLKKVVVESADSANE
YADIPIKIGSTINSDMHFDSRNLYIYVMSSNEVAKVKVYDCSDYSTCGECLGARDPYCGW
CSLENKCSPRSSCQDDANDPLYWVSYKTGKCTTITSVVPHQLQRTTARTLELIIDHLPQL
KENLVCAFTTEEKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTKDGPDL
VSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPSYR
SGPGFCPTINATGEGSEMLVAAGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLNAQ
LLGDTIYCDNMEFQYTSRSPNLTATFAVIWGGSKPLDNPHDIHVVIYRCRDMADSCGMCL
ALAEKYNCGWCSSTNTCEVEEQCNKNNEGPWEGGTNITIRGINLGKNFSDIYSGVRIAGI
SCMPFQQFYVDTKEIVCNVDSPGVQLYRNGRIVVQIGDYRGESKEDYEFVDPKITNFSPQ
YGPVSGGTHLRIIGKYLNAGSRIQAFINEHLRCDILSVDVTEAICRTAPSPGIIEGRLKM
LFDNGQREFNEYNFKYVLDPTIDQVSSGPISQLKVPRGIPAGGIEIVVTGTQFNYIQNPR
MYVYYKNKIFYSQCKVKSATHMICYSPVIETDNDILNAENPVLLEYGFLMDNVLRVQNLS
SIHNNHFELYPNPLYFNFEEDIKYYKSEYLTINGRNLDRACKETDVVVRIGKGICNITSL
SRQQLTCRPPPESATESSNESGPEVIVRIGQSLEYRIGVLSYASPNLMHDLSKNVLLVIG
VGTVAILMIFVALLVAYKKKTSESNRVLRNMQEQMDILELRVAAECKEAFAELQTEMTDL
TGDLTSGGIPFLDYRTYAMKILFPNHEDHIVLQWERPELLRKEKGLRLFGQLIMNKTFLL
LFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYCTDILKTLLGDLIEKCIEGKSHPKLL
LRRTESVAEKMLSAWFTFLLYKFLKECAGEPLYMLFRAVKGQVDKGPVDACTHEARYSLS
EEKLIRQLIDFRPMTVYASIIQQPIFCNSIDMMPTHTENVPVKVLDCDTIGQVKDKCVDT
IYRNIPSSQRPRKDDLDLEWRTGASGRVILYDEDTTSKTESEWKKLNTLQHYNVPDGAGL
SLVPKQSSNYNFSILSDKNEKCHKYETLNLSKYTSSSPTFSRAGSPLNNDLHENGVKCWH
LVKHHDSDIQKEGERVNKLVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAI
KYMFDFLDDQAILHGITDHEVVHTWKSNSLPLRFWVNLIKNPNFVFDIHKSNIVDSCLSV
VAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYRKWVERYYRDIREMPSISDQDMNAML
AEESRLHTTEFNTNCALHELYTYAVKYNEQLTVTLEEDEFSQKQRLAFKLEQVHNMMSGE
Download sequence
Identical sequences XP_012162995.1.71379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]