SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012180535.1.98339 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012180535.1.98339
Domain Number 1 Region: 453-498,535-573
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000827
Family UBX domain 0.05
Further Details:      
 
Domain Number 2 Region: 229-317
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000268
Family Thioltransferase 0.043
Further Details:      
 
Weak hits

Sequence:  XP_012180535.1.98339
Domain Number - Region: 7-50
Classification Level Classification E-value
Superfamily UBA-like 0.000684
Family TAP-C domain-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012180535.1.98339
Sequence length 604
Comment predicted protein [Fibroporia radiculosa]; AA=GCF_000313525.1; RF=representative genome; TAX=599839; STAX=599839; NAME=Fibroporia radiculosa; strain=TFFH 294; AL=Scaffold; RT=Major
Sequence
MDVDALSPSQKDALGQLQALMNGGDADVAIGVLDSVNWDVQRAAEMIFDNGVPPPLSRPG
SRTNIEHFEVDDSEQGLLIPTSSGREFRPVRTPSSGLTVRPVRALIAVITLPLRLITSIL
RFLFRILRVPFPQFVPFTWSSLSYRSHGLGNRHDSRLMDPRSVAERWVRALEEETGAVCI
SRSGARNNLDSSVNDHGVSSGTDAAGPSTLTARMGPNDSTVEDVELKSLPDFFLGSYENF
VRTCEKSAKIGCVILVSEEHDDVPEFKRSTLTDPTLLKLVQENDIIVWGGDIRDKDPWSA
SQKLQATTYPFVAFIALQARRTTGPGTASAPTLTILSRHQGPCIPSTSAPTAAQTLATHL
TDHLLPRVTPFLARIKAQAAERERERALRAEQDRAFEESRQRDKERVERRLAEDKRAEDE
RRLRAEAEEQRRAWHARRMDWRRYERRALVTREPRPGESGRGKTMRVGLRLPDGRRLVRF
FGESDSMTALHAYVDSHFIPAELAPDSDPHAPPGGATPGEIGLVEEVQSSGRSETQWWGF
QLVLAYPRKELAWEPSRRLGDVDVLKSGGQLVVEMVGDMGSGDGKGKEKAAAAENSDDGY
ETED
Download sequence
Identical sequences J4HVX1
XP_012180535.1.98339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]