SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012195134.1.39859 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012195134.1.39859
Domain Number 1 Region: 282-554
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000646
Family Ankyrin repeat 0.011
Further Details:      
 
Domain Number 2 Region: 141-239
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000942
Family Pseudo ankyrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012195134.1.39859
Sequence length 641
Comment hypothetical protein SPRG_01535 [Saprolegnia parasitica CBS 223.65]; AA=GCF_000151545.1; RF=representative genome; TAX=695850; STAX=101203; NAME=Saprolegnia parasitica CBS 223.65; strain=CBS 223.65; AL=Scaffold; RT=Major
Sequence
MRDLLARIDGLDQVLSTRILDFAGPLSLYLLDRGIWANAQSRHSNADIEAVYADAYAMDW
PGDLATLPGGGPSRERDRSSRSFEHIRTLPMYERYQAAIGHSVTLVHGFRDGYDTNGREA
RRRNMSFDIQPSSLDDVGLRNCWDFAVTPFLDRPIALAHAAAYNGSAELLYALGDDYGVE
LARLRDAPDSKELLMDYAASRGYLDVLMCLHAAGNNHCTTHAMDDAIANGHLKVVAWLHL
ARDEGCSHHGFDVAYKQRTKQPNGAAILAFLEDARGYGFTETSLIEAATVGDLRFLRAAV
SVPCTTRVMDAAAGSDQLDVLQFLHRHRAEGCSEAALMGGAAIGSLPVVTFLCTHYHDAS
HLVKAMTEAARHGHLHIVQYLHGLVPVGTAGTKPMNAALRKDRVEIVHFLQAHRPSEGCT
SRALEDALWNIDEDLYTFLVGVRPELLSQTTLEAAAGHGQEDIVWDHYARGFRSHRAMAW
AAQWGEFDWVRQHHEVFNEPCTDEATDRAAGQGFEEIASYLLANGASFTYQGIYKAACNY
KYATLALLVGRDETKHRCNLAIARALSAGFVRAAQDIYNAAGFTGALAGWKRYASLINPA
TEDLPEDLDVRNAEIDSDLEYNSDDEIEDEGEDSDYEDFDY
Download sequence
Identical sequences A0A067CUK7
XP_012195134.1.39859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]