SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012195302.1.39859 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012195302.1.39859
Domain Number 1 Region: 43-159
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000484
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012195302.1.39859
Sequence length 174
Comment hypothetical protein SPRG_19109 [Saprolegnia parasitica CBS 223.65]; AA=GCF_000151545.1; RF=representative genome; TAX=695850; STAX=101203; NAME=Saprolegnia parasitica CBS 223.65; strain=CBS 223.65; AL=Scaffold; RT=Major
Sequence
MSVQVAEEGNKRKGGMTAEETEQCIFDILSWFQRKKANLPKATIAPEEVESLQKALGVPV
PRALGYLLEKQNGGVWFNEYKSLSCDDMISTGETASRWESWARGFIPLAADPDGNLLVID
TKHANAVHECSEDGLGRELAASFSAYVETYRNDLLSGNFDFVEDLGLVERASRK
Download sequence
Identical sequences A0A067D6J2
XP_012195302.1.39859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]