SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012232646.1.42766 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012232646.1.42766
Domain Number 1 Region: 60-511
Classification Level Classification E-value
Superfamily Sema domain 4.71e-134
Family Sema domain 0.0000237
Further Details:      
 
Domain Number 2 Region: 1384-1512,1717-1905
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-43
Family p120GAP domain-like 0.047
Further Details:      
 
Domain Number 3 Region: 868-965
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000446
Family Other IPT/TIG domains 0.0048
Further Details:      
 
Domain Number 4 Region: 962-1050
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000306
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.059
Further Details:      
 
Domain Number 5 Region: 514-565
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000419
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 1067-1150
Classification Level Classification E-value
Superfamily E set domains 0.00000000255
Family Other IPT/TIG domains 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012232646.1.42766
Sequence length 1937
Comment PREDICTED: plexin-A4 [Linepithema humile]; AA=GCF_000217595.1; RF=representative genome; TAX=83485; STAX=83485; NAME=Linepithema humile; AL=Scaffold; RT=Major
Sequence
MLSVFPAATTEMMRTARSVVSRPRRRCWYRSPLLLILILTLSLSSRLPTAHSVPADIVQK
FHDPEVERMNHLVVDKNTGRVYVGAVNRLYQLSPDLLLVVKEVTGPKGDSTACSMLDCPR
EAQKRPVDNVNKALVIDYTTTRLISCGSLFQGMCTVRNLHNISDVVQEVKEAVVANNATA
STVAFIAPGPPNPPVSQVMYVGVTFTGNSPYRSEVPAVSSRSLDKDKMLNIAEAAVTTGT
RMYVNSLSRERYPINYIYGFSSGGFSYFLTTQMKNTETPIYLSKLVRVCQDDEHYYSYTE
IPINCTSDERIYNLVQAAYVGKAGSVLAGDLGITAQDDVLFAVFAESDGPNSDVPRPHSA
LCVYSLKAIRRKFMSNIQRCFSGEGQRGLEFISPSHKCISTKLQTIGEDFCGLDVNTPLG
GEEPMGATAVLTFETHLTAVAATSTGDYTVVFVGTNKGHLKKVVVESSTLALEYGDLEID
PGSPVNPDLLFDSQLMHLYVLTEKKVSKVKVQECSVYKTCWDCLGAKDPYCGWCSLENKC
NLRSDCQDAAKDPLYWISYKSGRCTTITAVTPDQLQRTTARTLELVIENLPTLSGQFLCA
FSALDKTLITNASRKSYGVNCTTPRTDLLPSIPPGRHHFTAKLSVRMTNGPDLVATNFTF
FDCNTYSSCTQCVSSSFPCDWCVDGHRCTHDTAENCRNDILVTGVSRMGPSYRSGPGFCP
TINATESQEILVAAGIKKAIRVKVHIIGQFIIQTRFVCQFNIEGRVTSVNARLLADTIYC
EETEFSYTSRAPNITVPFAVIWGGSKPLDNPDNIHLVIYRCRDMADNCGMCLALPSKYGC
GWCQTGFKCEVKDQCDRGSGMWLNSNQTCPNPEIKSFEPIMGPWEGNTNVTIRGINLGKT
FKDIVSGVTVAGMRCLPYEELYIRTKQIVCRVDGPGTQEGKSGPVIVKIEDFRGESTYNF
EFVDPQIISISPKYGPLSGGTTIKITGNYMNAGSTIHADIDDLPCSIISAEPNEALCMTS
PSDRKRSGMLKMSFDGGNRLYDGFFEYVDDPTIESVESGVAGQMKVPKGIPAGGIKISVT
GKNLGYIQSPQMYVYYDEKMFVSQCEVHSQESMVCKSPTIEVPEHVMLDAERPLALEYGF
RMDNVTGVQNLSQHGFSHFLLYPNPIYEVFDEEVKYYKSDYLTINGQHLDRACQESDVVV
QIGNAFCNVTSLSRQQLTCRPPLTQPPAIDAQGLPNKQELPEVVLIVGGTLRYNIGKLSY
ALPAGLNGPLSKPALIGVIAAIVILVFVFIAFLIAYRRKSTESNRVLKNMQEQMDILELR
VAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRTYAMMILFPSDDNSPVLPGDRPELAR
KEKGLRLFGQLIMNKTFLLLFVRTLESNRYFSMRDRVNVASLIMVTLQSKMEYCTDILKT
LLADLIEKCTEGKSHPKLFLRRTESVAEKMLSAWFTFLLYKFMRECAGEPLYVLFRAVKQ
QVDKGPVDAITSEARYSLSEEKLIRQSIDFKPMTVYVSISQQTVFVGGMDPNTENVPVKV
LDCDTISQVKEKALDTIYRATPYSQRPRKEDLDLEWRTGASGRLILYDEDSTTKTEGEWK
KRNTLNHYRVPDGASLNLVSKQSSIYNLSILSEKTDKSHKYETLNLSKFSSASPPLSRAT
SPLNQNHEGGMKVWHLVKHHDSDARKEGDRGNKMVSEIYLTRLLATKGTLQKFVDDLFET
IFSTAHRGSALPLAIKYMFDFMDDQALQHGISDPEVVHTWKSNSLPLRFWVNLIKNPNFI
FDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPVYKEWVERYYSDI
KVMPAISDQDMNAMLAEESRLHTAEFNTNCALYELYTYAGKYNEQLIVTLEEDEFSQKQR
LAYKLEQVHNIMAADNP
Download sequence
Identical sequences XP_012232646.1.42766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]