SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012234067.1.42766 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012234067.1.42766
Domain Number 1 Region: 138-420,457-556
Classification Level Classification E-value
Superfamily L domain-like 4.08e-51
Family Ngr ectodomain-like 0.041
Further Details:      
 
Domain Number 2 Region: 851-994
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.4e-27
Family Toll/Interleukin receptor TIR domain 0.0002
Further Details:      
 
Domain Number 3 Region: 654-767
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000193
Family Ngr ectodomain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012234067.1.42766
Sequence length 1022
Comment PREDICTED: protein toll-like [Linepithema humile]; AA=GCF_000217595.1; RF=representative genome; TAX=83485; STAX=83485; NAME=Linepithema humile; AL=Scaffold; RT=Major
Sequence
MCTRRKICFAILLVVVCSVSASLCPENKICSCEWSIRDTIEIICKINNSSIDIEFESIES
IKVTCSNANWSDFQLYNLTKRSVKNMYFYNCDLPKDSSLKTITDMLGATNVEKLVFHSYK
NLSSFKRLHLNGFVNLRLLDLSNNIISSIDTDLLADLPNLIRLNLRKSNLITVTPLSDHD
SKLQELDLGENRLEWIKPDIFDKFYNLTWLSLEKNNLTKFKSRIFDKLVNVLLINLFSNN
LVSLPENIFGKLKNLETLSLAENNFTLLPRYLLQNNTNLRIIDLSFNKKKLNTLPDGFFR
NLTKLEMLKVEKDGLTLLPEDLLWGCFSLTSLTLSRNDLGFLPKLIFRDLKELRELKLDS
NAFRKLPNIFQDLKQLKKLDLSKNYISFIDNEVFKELEYLEELNMAENSLILISERSFIF
LHSLQIANFSHNNLTLNIVTSNDHNDDDITESPFASCYLLKKLYLSHNRISEMFSDWVID
MEHLQKLDLRNNYISHLSAEDLQFASENIEVDLTYNKIRSISLNNAKDIFKNDWSNHAVI
LIEHNPLHCDCELYDYLRYLEGGMNPIMEKYINIDPKNLTCFVPLKLRHMRIIDLQSKLF
TCTMNADIYIDSICPDKCSCFRNLEDEAFIIDCFGRNFTVVPSVKNIPHKFWQIKLNLSN
NQLTEMPNLKELGYGPVRTLILSNNNISEISLNKLPESLEVLELHNNKISKMSSNVLNFL
TCCTNLYLVTLHGNPFICNCSTTDFFTFIHTFKSHIIADLHRITCQEKNKFISKMTITDF
CPNYMDNNTTGWSGRNISLIIFVIVGLFISIIGLLYYMYRKQFKRKLYEHRSIIEFAEND
EEDGKEEETNIDEEVCYDVFVSYSQDDHVFVMNNFVHVLENGLKPLKLYLPYRDWSVSEW
TTANIIKSAKLSGQMMMVLSPSFLENVWGKMELRVALCQAWEKYQADVILILYGEIEPTD
KHLDSELRNFINANIYIKWGDPWFWKKLGQLLKHDVKDKANRSEPAFLDYPNQGSSETLL
SN
Download sequence
Identical sequences XP_012234067.1.42766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]