SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012251755.1.80111 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012251755.1.80111
Domain Number 1 Region: 510-673
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 5.89e-68
Family A middle domain of Talin 1 0.0000128
Further Details:      
 
Domain Number 2 Region: 2315-2505
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.62e-53
Family I/LWEQ domain 0.00015
Further Details:      
 
Domain Number 3 Region: 680-803
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.83e-51
Family I/LWEQ domain 0.0000274
Further Details:      
 
Domain Number 4 Region: 773-910
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.16e-44
Family I/LWEQ domain 0.0000491
Further Details:      
 
Domain Number 5 Region: 1868-1993
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.52e-35
Family VBS domain 0.00012
Further Details:      
 
Domain Number 6 Region: 1245-1379
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.37e-32
Family VBS domain 0.035
Further Details:      
 
Domain Number 7 Region: 205-319
Classification Level Classification E-value
Superfamily Second domain of FERM 5.89e-30
Family Second domain of FERM 0.000013
Further Details:      
 
Domain Number 8 Region: 320-411
Classification Level Classification E-value
Superfamily PH domain-like 3.07e-26
Family Third domain of FERM 0.0000442
Further Details:      
 
Domain Number 9 Region: 1097-1228
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.15e-16
Family VBS domain 0.057
Further Details:      
 
Domain Number 10 Region: 1489-1573
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000000000196
Family I/LWEQ domain 0.0084
Further Details:      
 
Domain Number 11 Region: 2030-2153
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000132
Family VBS domain 0.02
Further Details:      
 
Domain Number 12 Region: 1612-1678
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000769
Family VBS domain 0.036
Further Details:      
 
Domain Number 13 Region: 83-141
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000036
Family First domain of FERM 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012251755.1.80111
Sequence length 2632
Comment talin-1 isoform X1 [Athalia rosae]; AA=GCF_000344095.1; RF=representative genome; TAX=37344; STAX=37344; NAME=Athalia rosae; AL=Scaffold; RT=Major
Sequence
MATLSLRISIPEKNATKMMQFDPTTSVYDACRVIREKLTDASGMGQPHDYGLFLADEDIK
KGVWLEPGRNLDYYILRNGDLLEYRRKLRTLRVRMLDGTLKTLLVDDSQPVANLMVVICT
KIGLTNHDEYSLVRELPDEETENAKPGNFGTLTLKRRKEEKGERDAKMDQLRKKLKTDDE
VNWIDPSQTLREQGIDEHETVLLRRKFFFSDQNIDSRDPVQLSLLYVQARDAILDGTHPI
IQEKACIFAGIQCQIQFGDYKEDKHKTGFLDLKEFLPQSYVKVKGIEKKIFAEHKKHAGL
SELDAKVLYTKTARSLNTYGVTFFLVKEKMKGKNKLVPRLLGITKDSVLRLDERTKEILK
TWPLTTVRRWGASPNTFTFDFGDYSDQYYSVQTTEAEQIVQLIAGYIDIIMKKQKSKDHF
GIEGDEGSTMVEDSVSPLQATIMQHETSSVGKGNIESVALPVVVRAGGDGARPYGTGHMG
SAQHSTVSGSANVTHAPPMIQQTRVTSVMSEPQRALVSTISEGHHIIRIAESELSSKAQL
PELGTDPASLKWIEQTMDTHKQNVGSQIAAMNAATAQVVTLTSGPADDVDHTAVGAAITT
IASNLPEMTKGVRMIAALLDDESSGDRLLDAARKLCLAFSDLLKATEPETKEPRQNLLNA
ASRVGEASHQVLTTIGEEDDSNRELQDMLLALAKAVANTTAALVVKAKNIATTCEDSVTQ
NRVISAATQCALATSQLVACAKVVAPTLHSPACQTQLMNAVREVTRAVEGLVEVCNETCT
DENLLKELSSAAAEVSRTLNDLLNRIQSATRAEKAKESVQEGAVETIFVATDKLFASTGD
AGEMVRQAKVVGQATAQLIHSIKGEAESQTDGEQQRRLLAAAKILADATAKMVEAARQCA
SSPHDANMQDQLRRAAEELRAATTAAATPGLRRKLITRLESCAKQAAANATQCISAASGA
AKHNTNAASQEELNAECRAVAQQVPNLVAGVKGTLAQPDNPTAQLNLINAAEQFLQPGSS
VIKAARAVVPTVSDQASAMQLNNSSQQLGSTLSDLRSAVTRAREACGGLELDAAEELINS
LKDELYEFYQAVEAARLRPLPGETAESTALQLGASSKNVGFAMAQLLSAAKQGNENYTGS
AARETATALKELTSAVRGVAATSNQPETQKKVLTTADDIIVRSLYLVKEARRALNNPDNP
ENVANLAAVAKDVSQSLNKCVSCLPGQRDVDDAIRNIDDMSQVLNMNEFPQTNKSYGQLQ
QNLNTAAADLNDASANVVSSVRSPVQLANTSKEFTSAFGDLLGVSMEMAGQTTTETRGQM
VVSLKNVSMTSSKLLVTAKSVAADPNAPNAKNQLSAAARAVTDSINYLIDVCTSAAPGQN
ECDNAIRNIQSMRPLLDNPSDPISDVSYFECLDTVMEKSKSLGDGMTGIANHAKKSEHEQ
FSVAVRGVSSSICGLVEAAAQAAYLAGVSDPTSVAGKPGLVDQAQFFRAAQAIHTGCQNL
TNPTSTPQQVLHAATMIAKHTSALCNACRVASSKTTNPVAKRHFVQSAKDVANSTGSLVK
EIKALDQDCSEANREKCSEATRPLLEAVDNLCNFASSPEFASQPAKISVAARAAQEPITS
AGKSIIDGSCAMVQAAKSLAVSPKDPPTWQLLANHSKSVSDSIKSLVASIRDKAPGQKEC
DAAIETLSSRIRELDAASLSVVSQALVPRKENTVQGFTDQMESSASELREKLEPLRSAAK
YGAEHVGHAVSQIALYSEPLVTGAIGAASNMVHSKQQMVLLDQTKTVAESTLQLIYVAKE
SGGNPKAVNLHAEVDETVESTKDALRELQNTLETISTSNGIVTGLIDTISRAMVRLEDHR
MSTIDTVDSYVDYQTRMVEAAKEIARLAQEMSTKSSVDVARLGPLAVDVSHKYTQLSRDA
SGASAATTNADVSLRLRTGVQELGRACADIVRAAGTCQMASGDAFAQREVSEHSKNVTEK
VSQVLAALQAGSRGTQACINAASTVSGIIGDLDTTIMFATAGTLHAENDSDIFADHRENI
LKTAKALVEDTKTLVAGAASSQEQLAVAAQNAVSTIVQLAEVVKYGAASLGSHNPEAQVM
LINAVKDVASALGDLIQATKTASGKPINDPSMAHLKDSAKVMVTNVTSLLKTVKAVEDEH
TRGTRALESTIEAIGQEIRSLNTPDVQRTPVTPEDLVRCTKNITTSTAKAVAAGNSCKQD
DIIAAANMGRKAISDMLLICKNAAYHCAETAELRDRTLNAGHDVALNYRELLQSILQISI
RPSDAKHLLPPISRKIAQSVTELVTVAELLKGNDWVDPDDPTVIAENELLGAAASIDAAA
KKLASLRPRRSIQEASEDMNFDEMILEAAKSIAAATSALIKAASAAQRELIATGKVSRTP
LTSSDDGQWSEGLISAARLVAAATHSLVESANALVQGVSSEEKLISSAKQVASSTAQLLV
ACKVKADPDSESTKRLQAAGNAVKRATDNLVRAAQQAIQQEEDRSLVLNRKMVGGIAQEI
NARSEVLRIERELEEARGRLTAIRQAKYKSKADTSDDAETDADQSGYESYTTRYETRAYE
PNHSRSPIQLMNSTLDDLQPTTQYISHRKLTESSTSVHVKKTMTRQVLKFEN
Download sequence
Identical sequences XP_012251755.1.80111 XP_012251756.1.80111 XP_012251758.1.80111 XP_020706645.1.80111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]