SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012275030.1.87881 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012275030.1.87881
Domain Number 1 Region: 572-632
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-16
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 144-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000125
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 316-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000228
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 489-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000138
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 5 Region: 621-655
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000146
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 543-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000185
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 7 Region: 430-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000082
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012275030.1.87881
Sequence length 1090
Comment PREDICTED: zinc finger and BTB domain-containing protein 41-like isoform X2 [Orussus abietinus]; AA=GCF_000612105.1; RF=representative genome; TAX=222816; STAX=222816; NAME=Orussus abietinus; AL=Scaffold; RT=Major
Sequence
MDMAGDLALQWVEEVGNVIHEEVICGLEAELTTPEEEVIGACEEVGVEEAVRSLPEPAPT
IHTEVLMIPQANDMESIYIVPQDQGHDYLNIQVTEEVIADSWDKSAPDDGVEIPETKVSH
DNLLEYDDMEIPLPIDQDSYTNTRPYPCDFCSRRFRKKANLMNHMVAHQTDRPHGCNLCG
ARYVRKCDLMNHLKIHAYAPSRDGLEDETNDDDSLLPDEEDSAKGRRKKVQCSAPRKRKN
SIVAKRHNEDVKADVNKYGNKSYDYINEDMRLLEEMTSRSSVRGRNYTTGSRWTEQTPLL
ASETPSPRWPITDPTKPYVCQHCGVGFAREKALASHARIHGGDSPFECTSCGDMFWDVNT
LREHVKVKHGGTAPSDTEEYDNDATYTGDERFGEFYCDTCSVPFHRLDLLKRHRKIHVKQ
ELDMLEGSSQHHVCNDCGEWFEEALALLAHAELHARSPSRRCLLCGERCRDDAEVAEHVQ
QNHAEDAPPNTCTLCGKTCKDKRSLLKHSWIHSADKTFSCTKCGKRFHSKARLRRHMVSH
RNKMVACDECGEEFPDGRALVSHRHSHNKDLGGRSFPCRECGKTFGSRSSQQIHIRIHTG
ERPYGCRFCWKAFADGGTLRKHERIHTGEKPYGCAICPRAFNQRVVLREHVRAHHSGPDP
KCHGSTMPYLCKVCGDAYSTSEEIVAHIVQHCDDNTAMRRQPQTGPRKYKRRRKLKPHES
NLMTRINENYDTLNALSDSDDSVKRKVGKKNKHRSNVEESYQSVLKSFESSLQNLNSLVS
NTKINPNKSKFTKKRIKREDKRHETPAAYQPGRPKMIHTQKTRVPVDVGSDGVKKGQKTK
TMVTRTPKVLPGEHKLGIFPGGERNRPRTKNVSYHVEGKLQPIPATFPSKTKEEVDKVSM
QFLANIKIEPGVHKGTSNNHSNNNGSIRGIVAERKTELPHRKKSMILRKVRKQRQTRIKQ
EPRDEVQESETAVPNEPELNLTSHLIDPAIDGSNLEVAYEANIETVEEETILPDLERIRH
CEVDTNRDVKLNVKMFETLPEKIVSTHHVLVNVNDVPETIIPDAVEYTCEMCSAVFSSRQ
ELLVHVPIHI
Download sequence
Identical sequences XP_012275030.1.87881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]