SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012292232.1.9421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012292232.1.9421
Domain Number 1 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.63e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-22
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 3 Region: 486-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.17e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.81e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 205-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 597-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-20
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 541-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.45e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 8 Region: 4-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.1e-19
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 9 Region: 150-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.5e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 644-695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.76e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 11 Region: 95-151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.42e-16
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 12 Region: 303-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000233
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012292232.1.9421
Sequence length 696
Comment zinc finger protein 607 isoform X1 [Aotus nancymaae]; AA=GCF_000952055.2; RF=representative genome; TAX=37293; STAX=37293; NAME=Aotus nancymaae; AL=Scaffold; RT=Major
Sequence
MACRSITFRDVAIDFSHQEWEYLNLVQKTLYQEVMMENYDNLVSLAGHSISKPDLITLLE
QGKEPWMIVREDTRGEYTDLDSRCEIISDRKMDIYRKHSSVTLHQRIHNGQKPYECKECQ
KAFSHLTELTVHQRIHTSEEPDQREEFGKAFSHLTDLREHQKIHAHEKPYECEECGKVFS
YPANLAQHGKVHVEKPYECKECGEAFRTSRQLTVHHRFHYGEKPYECKECGKAFSVYGRL
SRHQSIHTGEKPFQCNKCGKSFRLKAGLKVHQSIHTGEKPHECKECGKSFRQFSHLVGHK
RIHTGEKPYECKECGKGFTCRYQLTMHQRIYSGEKPYECKENGEAFSSSHQFTAPHTFES
IEKPYKCEECGKAFSVYGRLTRHQGIHSGKKPFECNKCGKSFRLNSSLKIHQNIHTGEKP
YECKECGKAFSQRAHLAHHNRIHTGYKPFDCKECGKSFRCASYLVIHERIHTGEKPYVCQ
DCGKGFSYSHKLTMHRRVHTGEKPYKCKECGKAFSVSGQLTQHLSVHSGKKPFECNQCGK
SFRFISVLKAHQNVHSAEKPYECKECGKAFRHATSLIYHDRTHVGEKSYECKECGETFSH
ASHLIIHERIHTSDTPYECKRCGKAFRCSSYLVRHERVHADGNPYMCEECGKAFNSSHEL
SIHHRVHTGEKPFKCNKCRRSFRLRSILEVHQRIHI
Download sequence
Identical sequences A0A2K5CRF8
XP_012292205.1.9421 XP_012292222.1.9421 XP_012292232.1.9421 XP_012292240.1.9421 XP_012292247.1.9421 XP_012292252.1.9421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]