SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012292257.1.9421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012292257.1.9421
Domain Number 1 Region: 260-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 372-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-22
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 3 Region: 485-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.17e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 4-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.18e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 5 Region: 428-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.55e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 204-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 7 Region: 596-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-20
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 8 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.34e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 9 Region: 149-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.5e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 643-694
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.76e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 11 Region: 94-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.42e-16
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 12 Region: 302-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000233
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_012292257.1.9421
Sequence length 695
Comment zinc finger protein 607 isoform X2 [Aotus nancymaae]; AA=GCF_000952055.2; RF=representative genome; TAX=37293; STAX=37293; NAME=Aotus nancymaae; AL=Scaffold; RT=Major
Sequence
MACRSITFRDVAIDFSHQEWEYLNLVQKTLYQEVMMENYDNLVSLGHSISKPDLITLLEQ
GKEPWMIVREDTRGEYTDLDSRCEIISDRKMDIYRKHSSVTLHQRIHNGQKPYECKECQK
AFSHLTELTVHQRIHTSEEPDQREEFGKAFSHLTDLREHQKIHAHEKPYECEECGKVFSY
PANLAQHGKVHVEKPYECKECGEAFRTSRQLTVHHRFHYGEKPYECKECGKAFSVYGRLS
RHQSIHTGEKPFQCNKCGKSFRLKAGLKVHQSIHTGEKPHECKECGKSFRQFSHLVGHKR
IHTGEKPYECKECGKGFTCRYQLTMHQRIYSGEKPYECKENGEAFSSSHQFTAPHTFESI
EKPYKCEECGKAFSVYGRLTRHQGIHSGKKPFECNKCGKSFRLNSSLKIHQNIHTGEKPY
ECKECGKAFSQRAHLAHHNRIHTGYKPFDCKECGKSFRCASYLVIHERIHTGEKPYVCQD
CGKGFSYSHKLTMHRRVHTGEKPYKCKECGKAFSVSGQLTQHLSVHSGKKPFECNQCGKS
FRFISVLKAHQNVHSAEKPYECKECGKAFRHATSLIYHDRTHVGEKSYECKECGETFSHA
SHLIIHERIHTSDTPYECKRCGKAFRCSSYLVRHERVHADGNPYMCEECGKAFNSSHELS
IHHRVHTGEKPFKCNKCRRSFRLRSILEVHQRIHI
Download sequence
Identical sequences XP_012292257.1.9421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]