SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012312390.1.9421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012312390.1.9421
Domain Number 1 Region: 54-236
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-42
Family Ankyrin repeat 0.00044
Further Details:      
 
Domain Number 2 Region: 243-302,387-424
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000248
Family Pseudo ankyrin repeat 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012312390.1.9421
Sequence length 477
Comment ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 isoform X1 [Aotus nancymaae]; AA=GCF_000952055.2; RF=representative genome; TAX=37293; STAX=37293; NAME=Aotus nancymaae; AL=Scaffold; RT=Major
Sequence
MAASALRGPAVAGGGESSDSEDDGWEIGYLDWTSQKLKGQTLPIEEKKEKFKKALTTGDV
SLVQELLDSGIISVDDTFRYGWTPLMYAASIANAELVRVLLDRGANASFEKDKQTILITA
CSAHGSEEQILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVASGAEVNTQ
DENGYTALTWAARQGHKSIVLKLLELGANKMLQTKDGKLPSEIAKRNKHYEIFNLLSFTL
NPLEGKLQQLTKEETICKILTTDSDRENDHIFSSCAAFGDLEVFLHGLGLEHMTDLLKER
DITLRHLLTMREDEFTKYGFTSKDQQKILAALKELEVEEIQFGDLSEEARLEISGDEFLN
FLLKLNKQCGHLITAVQNIITELPVNSQKIVLEWASPQNFTSVCEELVNNVEDLSEEVCN
LKDLIQKLQNERENDPTHIPLREEVSTWNSRILKRTAITVCGFGFLLFICKITFQRK
Download sequence
Identical sequences A0A2K5CYP8
XP_012312390.1.9421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]