SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012316104.1.9421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012316104.1.9421
Domain Number 1 Region: 2210-2303
Classification Level Classification E-value
Superfamily C-type lectin-like 3.53e-33
Family Link domain 0.00011
Further Details:      
 
Domain Number 2 Region: 508-646
Classification Level Classification E-value
Superfamily FAS1 domain 1.18e-29
Family FAS1 domain 0.0019
Further Details:      
 
Domain Number 3 Region: 1472-1520,1598-1714
Classification Level Classification E-value
Superfamily FAS1 domain 1.2e-24
Family FAS1 domain 0.0039
Further Details:      
 
Domain Number 4 Region: 1716-1869
Classification Level Classification E-value
Superfamily FAS1 domain 5.89e-24
Family FAS1 domain 0.0046
Further Details:      
 
Domain Number 5 Region: 964-1121
Classification Level Classification E-value
Superfamily FAS1 domain 2.35e-22
Family FAS1 domain 0.0078
Further Details:      
 
Domain Number 6 Region: 384-498
Classification Level Classification E-value
Superfamily FAS1 domain 8.11e-20
Family FAS1 domain 0.0062
Further Details:      
 
Domain Number 7 Region: 2301-2464
Classification Level Classification E-value
Superfamily FAS1 domain 2.09e-16
Family FAS1 domain 0.01
Further Details:      
 
Domain Number 8 Region: 1139-1230
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000562
Family FAS1 domain 0.0096
Further Details:      
 
Domain Number 9 Region: 1544-1581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000102
Family Merozoite surface protein 1 (MSP-1) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_012316104.1.9421
Sequence length 2570
Comment stabilin-1 isoform X5 [Aotus nancymaae]; AA=GCF_000952055.2; RF=representative genome; TAX=37293; STAX=37293; NAME=Aotus nancymaae; AL=Scaffold; RT=Major
Sequence
MAGPWGLLPLCLLAFYLAGFSFIRGQGPSKRCDVKTTLATHVPCTSCAAVKKQTCPPGWL
RELPDQIAQDCRYEVQLGGSMVSMSGCRRKCWKYIVEKACCPGYWGSQCYECPGGAETPC
NGHGICLDGINRNGTCVCQENFHGSACQECQDPNRFGPDCQSVCSCVHGVCNHGPRGDGS
CRCFAGYTGPHCDQELPICQELRCPQNTQCSAEAPSCRCLPGYTQQGSECQAPNPCWPSP
CSPLAQCSVSSTGQARCHCPENYHGDGMVCLPKDPCTDNFAGCPSNSTLCVYQKPGQASC
ICRSGLVSINSNASGGCQAFCSPYSCDRSATCQVTADGKTSCVCKQGEVGDGRACYGHLL
HEVQKAMQTGRVFLQLRVAMAMMDQGCREILTTAGPFTVLVPSVLSSSSRTMNASLAQQL
CRQHIIAGQHILEDTKTQQTRRWWTLAGQEITVVFNQFTKYSYKYKDQPQQTFNIYKPNN
VAANGIFHVVTALRWQPPSGISGDPKRTISQILASTEAFSRFETILENCELPSILDGPGP
FTVFAPSNKAVDSLRDGRLIYLFTTGLSKLQELVRYHVYNHGQLTVEKLISKGRILTMAN
QVLVVNISEEGRILLGPEGVPLQRVDLLASNGVIHMLDGILLPPTILPILPKHCSEEQHK
IVVGSCVDCHALNTSTCPLNSVKLDILPKECVYIHDPTGLNVLKKGCASYCNQTIMKQGC
CKGFFGPDCTQCPGGFSSPCYGKGNCSDGIQGNGACLCFPDYKGIACHICSNPNKHGDQC
QEDCGCVHGLCDNRPGSRGVCQQGTCAPGFSGHFCNETVRYCGPIEMAVHCHLHAHCVSQ
GGFARCRCLDGFEGNGFSCTPSNPCSHPDRGGCSENAECVPGARGTHNCTCHKGWSGDGH
VCVAIDECELDTRGGCHADALCSYVGPGQSRCTCKTGFAGDGYQCSPIDPCRAGNGGCHS
LATCQAVGGGQRVCTCPPGFGGDGLSCYGDIFQELEANAHFSVFYQWFKNASITLPADHQ
VTALVPSEAAVHRLSPKDQAFWLQPRMLPNLVRAHFLQGAFFEKELARLSGQEAATLDPS
THWEIRNISGRVWVQNASVDVADLLATNGVLHIISQVLLPPRGDVPGVQGLLQQLDLVPA
FSLFRDLLQHHRLVPQIEAATAYTIFVPTNHSLEAQGNSSHLDADTVRHHVILGEALSME
ALGKGGHRNSLLGPAHWIVFYNHSGQPEVNHVPLEGPMLEAPGRSLIGLSGVLRVGSSRC
LHSHAEALREKCVNCTRKFRCTQGYQLQDTPRKSCVYRSGFSFARGCSYTCAKKIQVPDC
CPGFFGTLCEPCPGGLGGVCSGHGQCQDRFLGSGECRCHEGFHGTACEMCELGRYGPNCT
GVCDCAHGLCQEGLQGDGSCVCNVGWQGLRCDQKIAGPQCPRKCDPNANCVQDSAGAPTC
ACAAGYSGNGTFCSEVDPCAHGHGGCSPHANCTKVAPGQRTCTCQDGYTGDGELCQEINS
CLIHHGGCHIHAECIPTGPQQVSCSCLKGYSGDGIRTCDLLDPCSKNNGGCSPYATCKST
GDGQRTCTCDTAHTVGDGLTCRTRLGLELQKDKHALFFASHLMEYKELKGDGPFTIFVPD
AYLMSNLLQDESRMARIRAHRLLVFRYHVIGCRRLRSEDLLEQGYATALSGHPLRFSERE
GSIYVNDFARVVSSDHEAVNGILHFIDRVLLPPEALHWEPGDAPVLRRNVTAAAQSFGYK
IVSSLLKMAGLLPLLRDPSHRPFTMLWPTDAALQALPLERQAWLYHEDHRDKLAAILRGH
IIRSVEGLASDLPNLGPLRTMHGTPISFSCSRMRPGELMVGEDDARIVQRHLPFEGGLAY
GIDQLLEPPGLGARCDRFETRSLKLNTCSICGMEPPCPQGSQDQGRTEGCWHLSSKLWMS
PSLRSLRLRSFWVQPSFWDRPEILGRGCHRNCVITTWKPSCCPGHYGSECQACPGGPSSP
CSDHGVCMDGMSGSGQCLCRSGFVGTACELCAPGAFGPHCQACRCTMHGHCDEGLGGSGS
CFCDEGWTGPRCEVQLELQPVCTPPCAPEAMCRAGNSCECSLGYEGDGHVCTVADLCQDG
HGGCSEHANCSQVGTVITCTCLPDYEGDGWSCRARNPCTDGHRGGCSEHADCLSTGLNTR
RCECHAGYVGDGLQCLEESEPPVDRCLGQPPPCHSDAVCTDLHFQEKRAGVFHLQATSGP
YGLNFSEAEAACEAQGAVLASFPQLSAAQQLGFHLCLMGWLASGSAAHPVVFPTADCGSG
RVGIVSLGARKNLSERWDAYCFRVQDVACQCREGFVGDGISTCNGKLLDVLAATANFSTF
YGMLLGYANATQRGVDFLDFLEDELTYKTLFVPVNEGFVDNMTLSGPDLELHASNATFLS
ANASQGKLLLAHSGLSLIISDVGPDNSSWAPVAPGTVVVSHVIMWDIMAFNGIIHALASP
LLAPPQPQVVLAPEAPPVAAGVGAVLAAGALLGLVAGALYLRTRGKPTGFGFSAFQVDDA
DFSTWQEGTNPTLVSVPNPIFGSHDAFCEPFDDSLLEEDFPDTQRILTVK
Download sequence
Identical sequences A0A2K5E493
XP_012316104.1.9421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]