SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_012322912.1.9421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_012322912.1.9421
Domain Number 1 Region: 132-244
Classification Level Classification E-value
Superfamily PH domain-like 1.28e-33
Family Phosphotyrosine-binding domain (PTB) 0.00000572
Further Details:      
 
Domain Number 2 Region: 7-110
Classification Level Classification E-value
Superfamily PH domain-like 5.48e-18
Family Phosphotyrosine-binding domain (PTB) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_012322912.1.9421
Sequence length 306
Comment docking protein 5 isoform X1 [Aotus nancymaae]; AA=GCF_000952055.2; RF=representative genome; TAX=37293; STAX=37293; NAME=Aotus nancymaae; AL=Scaffold; RT=Major
Sequence
MASNFNDIVKQGYVRIRSRRLGIYQRCWLVFKKASSKGPKRLEKFSDERAAYFRCYHKVT
ELNNVKNVARLPKSTKKHAIGIYFNDDTSKTFACESDLEADEWCKVLQMECVGTRINDIS
LGEPDLLATGVEREQSERFNVYLMPSPNLDVHGECALQITYEYICLWDVQNPRVKLISWP
LSALRRYGRDTTWFTFEAGRMCETGEGLFIFQTRDGEAIYQKVHSAALAIAEQHERLLQS
VKNSMLQMKMSERAASLSTMVPLPRSAYWQHITRQHSTGQLYRLQDVASPLKLHRTETFP
AYRSEH
Download sequence
Identical sequences A0A096NNK9 A0A2K5C028 A0A2K5LA12 A0A2K5Z1L6 F7BN10
XP_002747737.1.60252 XP_011833520.1.47321 XP_011914355.1.92194 XP_012322912.1.9421 ENSPANP00000014569 ENSCJAP00000004727 ENSCJAP00000004732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]